Eutypa lata: UCREL1_5469 Help Entry UCREL1_5469       CDS       T03103                                  Name (GenBank) putative rho gtpase protein   KO K04392   Ras-related C3 botulinum toxin substrate 1 Organism ela  Eutypa lata Pathway ela04145   Phagosome ela04148   Efferocytosis ela04620   Toll-like receptor signaling pathway ela05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:ela00001]  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     UCREL1_5469    04148 Efferocytosis     UCREL1_5469  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     UCREL1_5469  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     UCREL1_5469  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:ela04131]     UCREL1_5469   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:ela04147]     UCREL1_5469    04031 GTP-binding proteins [BR:ela04031]     UCREL1_5469 Membrane trafficking [BR:ela04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     UCREL1_5469  Endocytosis   Lipid raft mediated endocytosis    Arf6-dependent endocytosis     UCREL1_5469   Macropinocytosis    Ras GTPases     UCREL1_5469  Others   NADPH oxidases (Nox) and associated proteins    Nox associated proteins     UCREL1_5469 Exosome [BR:ela04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    UCREL1_5469   Exosomal proteins of other body fluids (saliva and urine)    UCREL1_5469   Exosomal proteins of colorectal cancer cells    UCREL1_5469   Exosomal proteins of bladder cancer cells    UCREL1_5469 GTP-binding proteins [BR:ela04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     UCREL1_5469 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf Motif Other DBs NCBI-ProteinID:  EMR67521 UniProt:  M7TCB1 LinkDB All DBs Position Unknown AA seq 199 aa AA seqDB search MAAPGVQSLKCVVTGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSASVMVDGKPISLGL WDTAGQEDYDRLRPLSYPQTDVFLICFSIVSPPSFDNVKAKWYPEIDHHAPNIPIILVGT KLDLREDPATLESLRSKRMEPVSYDQALVCAKEIRAHKYLECSALTQRNLKSVFDEAIRA VLNPRPAPTKVKKSKCTIL NT seq 600 nt NT seq  +upstreamnt  +downstreamnt atggctgctccaggtgttcagtctctcaagtgtgtcgttaccggtgacggtgctgttggc aagacatgtcttctcatctcgtacacgaccaatgccttccccggcgagtacatccccact gtcttcgacaattactctgctagtgtcatggtagacggcaagcctataagcttgggtctc tgggatactgcgggtcaggaggattacgacagacttcgacctctgtcatacccccagaca gacgtcttcttgatctgcttctccattgtcagccctccctcttttgacaacgtcaaggcg aagtggtatcctgaaattgatcatcatgctcccaacatcccgatcattctcgttggtacc aagctggatcttcgagaggatcctgcgacgcttgagagcctgcgatccaagagaatggag ccagtctcatacgaccaggctttggtttgcgctaaggagatccgtgctcacaagtacctt gagtgttccgctcttacgcagagaaacctcaagagtgtattcgatgaagctattcgtgcc gtcctaaacccccgccccgctcccacgaaggtcaagaagtcgaagtgcaccatcctatga

DBGET integrated database retrieval system