Candidatus Electrothrix laxa: KKHLCK_12215 Help Entry KKHLCK_12215      CDS       T10500                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism elax  Candidatus Electrothrix laxa Pathway elax01100   Metabolic pathways elax01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:elax00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     KKHLCK_12215 (acpP)    00074 Mycolic acid biosynthesis     KKHLCK_12215 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     KKHLCK_12215 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding DUF7080 PP-binding_2 Ribosomal_L12_N Motif Other DBs NCBI-ProteinID:  CAK8722952 LinkDB All DBs Position 1:complement(2898314..2898547) Genome browser AA seq 77 aa AA seqDB search MAVADKMIDIIEEQLSVDKEKIVPGASFVDDLGADSLDLVELIMAMEEEFEVEIPDEDAE KIATVQDAINYVDNIQA NT seq 234 nt NT seq  +upstreamnt  +downstreamnt atggcagttgcagacaagatgattgatattattgaagaacagctcagtgttgataaggaa aaaatagttcctggagcatcttttgttgatgatctcggtgcggattcccttgatctcgtc gaactgatcatggctatggaagaagagtttgaggtcgagattcctgatgaagatgcagag aaaattgcaactgtccaggatgcaattaattacgttgataacattcaggcgtaa

DBGET integrated database retrieval system