Escherichia coli clone D i14: i14_0798
Help
Entry
i14_0798 CDS
T02003
Symbol
gpmA
Name
(GenBank) phosphoglyceromutase
KO
K01834
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:
5.4.2.11
]
Organism
elc
Escherichia coli clone D i14
Pathway
elc00010
Glycolysis / Gluconeogenesis
elc00260
Glycine, serine and threonine metabolism
elc00680
Methane metabolism
elc01100
Metabolic pathways
elc01110
Biosynthesis of secondary metabolites
elc01120
Microbial metabolism in diverse environments
elc01200
Carbon metabolism
elc01230
Biosynthesis of amino acids
Module
elc_M00001
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
elc_M00002
Glycolysis, core module involving three-carbon compounds
elc_M00003
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:
elc00001
]
09100 Metabolism
09101 Carbohydrate metabolism
00010 Glycolysis / Gluconeogenesis
i14_0798 (gpmA)
09102 Energy metabolism
00680 Methane metabolism
i14_0798 (gpmA)
09105 Amino acid metabolism
00260 Glycine, serine and threonine metabolism
i14_0798 (gpmA)
09180 Brite Hierarchies
09182 Protein families: genetic information processing
04131 Membrane trafficking [BR:
elc04131
]
i14_0798 (gpmA)
09183 Protein families: signaling and cellular processes
04147 Exosome [BR:
elc04147
]
i14_0798 (gpmA)
Enzymes [BR:
elc01000
]
5. Isomerases
5.4 Intramolecular transferases
5.4.2 Phosphotransferases (phosphomutases)
5.4.2.11 phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
i14_0798 (gpmA)
Membrane trafficking [BR:
elc04131
]
Autophagy
Chaperone mediated autophagy (CMA)
Selective cargos
i14_0798 (gpmA)
Exosome [BR:
elc04147
]
Exosomal proteins
Exosomal proteins of bladder cancer cells
i14_0798 (gpmA)
Exosomal proteins of melanoma cells
i14_0798 (gpmA)
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
His_Phos_1
Hda_lid
Motif
Other DBs
NCBI-ProteinID:
AER88305
LinkDB
All DBs
Position
complement(808534..809301)
Genome browser
AA seq
255 aa
AA seq
DB search
MRSKYMAVTKLVLVRHGESQWNKENRFTGWYDVDLSEKGVSEAKAAGKLLKEEGYSFDFA
YTSVLKRAIHTLWNVLDELDQAWLPVEKSWKLNERHYGALQGLNKAETAEKYGDEQVKQW
RRGFAVTPPELTKDDERYPGHDPRYAKLSEKELPLTESLALTIDRVIPYWNETILPRMKS
GERVIIAAHGNSLRALVKYLDNMSEEEILELNIPTGVPLVYEFDENFKPLKRYYLGNADE
IAAKAAAVANQGKAK
NT seq
768 nt
NT seq
+upstream
nt +downstream
nt
ttgaggagtaagtatatggctgtaactaagctggttctggttcgtcatggcgaaagtcag
tggaacaaagaaaaccgtttcaccggttggtacgacgtggatctgtctgagaaaggcgta
agcgaagcaaaagcagcaggtaagctgctgaaagaggaaggttacagctttgactttgct
tacacctctgtgctgaaacgcgctattcataccctgtggaatgtgttggacgaactggat
caggcatggctgcccgttgagaaatcctggaaactgaacgaacgtcactacggtgcgttg
cagggtctgaacaaagcggaaaccgctgaaaagtatggcgacgagcaggtgaaacagtgg
cgtcgtggttttgcggtgactccgccggaactgactaaagatgatgagcgttatccgggg
cacgatccgcgttacgcgaaactgagcgagaaagagctgccgctgacggaaagcctggcg
ctgaccattgaccgcgtgatcccttactggaatgaaaccattctgccacgtatgaagagc
ggtgagcgcgtcatcatcgccgcacacggtaactcgttacgtgcgctggtgaaatatctc
gataacatgagcgaagaagagattcttgagctgaatatcccgaccggcgtgccgctggtt
tatgagtttgacgagaacttcaaaccgctgaaacgctattatctgggtaatgctgacgag
atcgcggcgaaagcagcggcggttgctaaccagggtaaagcgaagtaa
DBGET
integrated database retrieval system