Escherichia coli clone D i14: i14_1248 Help Entry i14_1248          CDS       T02003                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism elc  Escherichia coli clone D i14 Pathway elc01100   Metabolic pathways elc01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:elc00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     i14_1248 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     i14_1248 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF1896 TerB DUF1493 HLH Ribosomal_L50 Motif Other DBs NCBI-ProteinID:  AER88748 LinkDB All DBs Position 1257297..1257533 Genome browser AA seq 78 aa AA seqDB search MSTIEERVKKIIGEQLGVKQEEVTNNASFVEDLGADSLDTVELVMALEEEFDTEIPDEEA EKITTVQAAIDYINGHQA NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcactatcgaagaacgcgttaagaaaattatcggcgaacagctgggcgttaagcag gaagaagttaccaacaatgcttctttcgttgaagacctgggcgcggattctcttgacacc gttgagctggtaatggctctggaagaagagtttgatactgagattccggacgaagaagct gagaaaatcaccaccgttcaggctgccattgattacatcaacggccaccaggcgtaa

DBGET integrated database retrieval system