Escherichia coli clone D i14: i14_3405 Help Entry i14_3405          CDS       T02003                                  Name (GenBank) hypothetical protein   KO K02078   acyl carrier protein Organism elc  Escherichia coli clone D i14 Pathway elc01100   Metabolic pathways elc01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:elc00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     i14_3405    00074 Mycolic acid biosynthesis     i14_3405   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     i14_3405 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding DUF1493 BH4 Motif Other DBs NCBI-ProteinID:  AER90860 LinkDB All DBs Position 3418705..3418953 Genome browser AA seq 82 aa AA seqDB search MVNREIVMDYILSCLQDLVENGVEIKPDSDLVNDLGLESIKVMDLLMMLEDRFDISIPIN ILLDVKTPAQLMETLLPWLEIK NT seq 249 nt NT seq  +upstreamnt  +downstreamnt atggtaaatcgtgaaatagtaatggattacatcctttcctgtttacaggatttggtcgaa aacggtgtggaaattaagcccgacagcgatctcgtcaacgatcttggcctggagtcgatc aaagtgatggatctcttaatgatgctggaagacagattcgatatttccattcctattaat attctgctggatgtcaaaacccctgcgcaattaatggaaactctacttccatggctggag attaaataa

DBGET integrated database retrieval system