Escherichia coli clone D i2: i02_0938
Help
Entry
i02_0938 CDS
T02004
Symbol
cydD
Name
(GenBank) cysteine/glutathione ABC transporter
KO
K16013
ATP-binding cassette, subfamily C, bacterial CydD
Organism
eld
Escherichia coli clone D i2
Pathway
eld02010
ABC transporters
Brite
KEGG Orthology (KO) [BR:
eld00001
]
09130 Environmental Information Processing
09131 Membrane transport
02010 ABC transporters
i02_0938 (cydD)
09180 Brite Hierarchies
09183 Protein families: signaling and cellular processes
02000 Transporters [BR:
eld02000
]
i02_0938 (cydD)
Transporters [BR:
eld02000
]
ABC transporters, eukaryotic type
ABCC (CFTR/MRP) subfamily
ABCC-BAC subgroup
i02_0938 (cydD)
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
ABC_membrane
ABC_tran
AAA_21
SMC_N
AAA_29
RsgA_GTPase
MMR_HSR1
AAA_22
AAA_16
nSTAND1
Dynamin_N
AAA_23
AAA_25
DUF815
Zeta_toxin
AAA_15
DUF2813
AIG1
Motif
Other DBs
NCBI-ProteinID:
AER83524
LinkDB
All DBs
Position
complement(949958..951724)
Genome browser
AA seq
588 aa
AA seq
DB search
MNKSRQKELTRWLKQQSVISQRWLNISRLLGFVSGILIIAQAWFMARILQHMIMENIPRE
ALLLPFTLLFLTFVLRAWVVWLRERVGYHAGQHIRFAIRRQVLDRLQQAGPAWIQGKPAG
SWATLVLEQIDDMHDYYARYLPQMALAVSVPLLIVVAIFPSNWAAALILLGTAPLIPLFM
ALVGMGAADANRRNFLALARLSGHFLDRLRGMETLRIFGRGEAEIESIRSASEDFRQRTM
EVLRLAFLSSGILEFFTSLSIALVAVYFGFSYLGELDFGHYDTGVTLAAGFLALILAPEF
FQPLRDLGTFYHAKAQAVGAADSLKTFMETPLAHPQRGEAELASTDPVTIEAEDLFITSP
EGKTLAGPLNFTLPAGQRAVLVGRSGSGKSSLLNALSGFLSYQGSLRINGIELRDLSPES
WRKHLSWVGQNPQLPAATLRDNVLLARPDASEQELQTALDNAWVSEFLPLLPQGVDTPVG
DQAARLSVGQAQRVAVARALLNPCSLLLLDEPAASLDAHSEQRVMEALNAASLRQTTLMV
THQLEDLADWDVIWVMQDGQIIEQGRYAELSVAGGPFATLLAHRQEEI
NT seq
1767 nt
NT seq
+upstream
nt +downstream
nt
atgaataaatcccgtcaaaaagaattaacccgctggttaaaacagcaaagcgtcatctcc
caacgttggctgaatatttctcgtctgctgggctttgtgagcggcatattgatcattgcc
caggcctggttcatggcgcgaattctgcaacatatgattatggagaatattccccgtgaa
gccctgctgcttccctttacgttactgtttctgacctttgtactgcgcgcatgggtggtc
tggttacgcgaacgggtgggttatcacgccgggcagcatatccgctttgccatccgccgt
caggttctcgaccgtctgcaacaagcagggccagcgtggattcagggtaaaccagcgggg
agctgggcgacgctggtactcgagcaaattgacgatatgcatgattactatgcacgctac
ctgccgcaaatggcgctggcagtgtcggtgccgctgctgattgtggtggctatcttcccc
tctaactgggccgcggcgctcattctgctgggcactgcaccgctaattccgttatttatg
gcgctggttggaatgggggctgccgatgctaaccgacgtaactttctcgctcttgctcgc
ttaagtgggcatttcctcgatcgcctgcgcggcatggaaacattgcgtatttttggtcgt
ggtgaagctgaaattgaaagtattcgttctgcttcggaagatttccgccaacggacaatg
gaagtgctacggctggcgtttttatcctccggcattctcgaattttttacctcgctgtcg
attgctctggtggcggtctactttggtttttcctacctcggcgagctggattttggtcac
tacgatactggcgtgacgctggctgcgggttttctggccctgatccttgcgccagagttt
ttccagccattacgcgatctcggtacgttttatcatgctaaagcccaggctgttggtgca
gctgacagtttgaaaacgtttatggaaaccccgctcgcccatccgcagcgcggtgaggcg
gaattagcatcgaccgatccggtgaccattgaagccgaggatctgtttatcacgtcgccg
gaaggtaaaacgctggccggaccgctgaattttactttgccagcaggccaacgagcagtg
ttggttggtcgcagcggttcaggtaaaagttcactgctgaacgcgctttctggttttctc
tcatatcagggatcgctacgaatcaacgggatagaattacgcgatttatcaccggaatca
tggcgtaaacatctctcctgggttgggcaaaacccacaattaccggcagcaacattacgg
gataacgtactactggcgcgacctgatgccagcgaacaagagttacaaacagcgctggat
aacgcctgggtcagtgagtttctaccgctcctgccgcaaggggttgatacgcctgttggc
gaccaggctgcccgcctttccgtggggcaggcgcagcgcgtggcggtggcccgtgcgtta
ctaaatccctgttcgctattactgttggatgaacccgctgccagccttgatgctcacagt
gaacagcgcgtaatggaggcgctgaatgccgcctctctgcgccagacaacgttaatggtc
acccaccagttagaagatcttgctgactgggatgtcatttgggtaatgcaggatggtcag
attattgagcaaggacgttacgcggaattaagtgtggctggcggcccattcgccacatta
ctggcccatcgtcaggaggagatttaa
DBGET
integrated database retrieval system