Escherichia coli clone D i2: i02_1248 Help Entry i02_1248          CDS       T02004                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism eld  Escherichia coli clone D i2 Pathway eld01100   Metabolic pathways eld01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:eld00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     i02_1248 (acpP)    00074 Mycolic acid biosynthesis     i02_1248 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     i02_1248 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 ACP_SdgA_C DUF1896 TerB HLH Motif Other DBs NCBI-ProteinID:  AER83829 LinkDB All DBs Position 1257297..1257533 Genome browser AA seq 78 aa AA seqDB search MSTIEERVKKIIGEQLGVKQEEVTNNASFVEDLGADSLDTVELVMALEEEFDTEIPDEEA EKITTVQAAIDYINGHQA NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcactatcgaagaacgcgttaagaaaattatcggcgaacagctgggcgttaagcag gaagaagttaccaacaatgcttctttcgttgaagacctgggcgcggattctcttgacacc gttgagctggtaatggctctggaagaagagtttgatactgagattccggacgaagaagct gagaaaatcaccaccgttcaggctgccattgattacatcaacggccaccaggcgtaa

DBGET integrated database retrieval system