Escherichia coli LF82: LF82_2617 Help Entry LF82_2617         CDS       T00854                                  Symbol ybgT Name (GenBank) Uncharacterized protein ybgT   KO K00424   cytochrome bd-I ubiquinol oxidase subunit X [EC:7.1.1.7] Organism elf  Escherichia coli LF82 Pathway elf00190   Oxidative phosphorylation elf01100   Metabolic pathways elf02020   Two-component system Module elf_M00153   Cytochrome bd ubiquinol oxidase Brite KEGG Orthology (KO) [BR:elf00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     LF82_2617 (ybgT)  09130 Environmental Information Processing   09132 Signal transduction    02020 Two-component system     LF82_2617 (ybgT) Enzymes [BR:elf01000]  7. Translocases   7.1  Catalysing the translocation of protons    7.1.1  Linked to oxidoreductase reactions     7.1.1.7  quinol oxidase (electrogenic, proton-motive force generating)      LF82_2617 (ybgT) SSDB OrthologParalogGFIT Motif Pfam:  YbgT_YccB Motif Other DBs NCBI-ProteinID:  CAP75209 LinkDB All DBs Position 727232..727345 Genome browser AA seq 37 aa AA seqDB search MWYFAWILGTLLACSFGVITALALEHVESGKAGQEDI NT seq 114 nt NT seq  +upstreamnt  +downstreamnt atgtggtatttcgcatggattctgggaacgcttcttgcctgttcgtttggggtaatcacc gcgctggcgcttgagcacgtcgaatcaggcaaagccggtcaagaagacatctga

DBGET integrated database retrieval system