Escherichia coli LF82: LF82_485 Help Entry LF82_485          CDS       T00854                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism elf  Escherichia coli LF82 Pathway elf01100   Metabolic pathways elf01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:elf00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     LF82_485    00074 Mycolic acid biosynthesis     LF82_485   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     LF82_485 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding DUF1493 Motif Other DBs NCBI-ProteinID:  CAP77442 LinkDB All DBs Position 3159801..3160049 Genome browser AA seq 82 aa AA seqDB search MVNREIVMDYILSCLQDLVKNGVEIKPDSDLVNDLGLESIKVMDLLMMLEDRFDISIPIN ILLDVKTPAQLMETLLPWLENN NT seq 249 nt NT seq  +upstreamnt  +downstreamnt atggtaaatcgtgaaatagtaatggattacatcctttcctgtttacaggatttggtcaaa aacggtgtggaaattaagcccgacagcgatctcgtcaacgatcttggcctggagtcgatc aaagtgatggatctcttaatgatgctggaagacagattcgatatttccattcctattaat attctgctggatgtcaaaacccctgcgcaattaatggaaactctacttccatggctggag aataactaa

DBGET integrated database retrieval system