Enterobacter ludwigii EN-119: BH714_14120 Help Entry BH714_14120       CDS       T04719                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism elg  Enterobacter ludwigii EN-119 Pathway elg01100   Metabolic pathways elg01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:elg00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     BH714_14120    00074 Mycolic acid biosynthesis     BH714_14120   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     BH714_14120 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  AOT44313 UniProt:  A0AAX3LIF9 LinkDB All DBs Position 2995880..2996137 Genome browser AA seq 85 aa AA seqDB search MQALHLEIKNLIITTLNLDELTAEDIDTDAALFGDGLGLDSIDALELGLAVKNQYGVVLS AESEEMRQHFFSVATLASFINAQRA NT seq 258 nt NT seq  +upstreamnt  +downstreamnt atgcaagcgcttcatcttgaaattaaaaatctcatcatcaccacgctgaatctggacgag cttaccgccgaggatatcgataccgatgctgcgctgtttggtgatggactgggtctcgac tctatcgacgccctcgaacttggcctggccgtgaaaaaccagtatggcgtggtgctgtct gccgaaagcgaagagatgcgtcagcacttcttttccgtcgccacgctggcttcttttatc aacgctcaacgcgcctga

DBGET integrated database retrieval system