Candidatus Electrothrix sp. GW3-4: WGN25_06680 Help Entry WGN25_06680       CDS       T11264                                  Name (GenBank) HU family DNA-binding protein   KO K03530   DNA-binding protein HU-beta Organism elgw  Candidatus Electrothrix sp. GW3-4 Brite KEGG Orthology (KO) [BR:elgw00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:elgw03032]     WGN25_06680    03036 Chromosome and associated proteins [BR:elgw03036]     WGN25_06680    03400 DNA repair and recombination proteins [BR:elgw03400]     WGN25_06680 DNA replication proteins [BR:elgw03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     WGN25_06680 Chromosome and associated proteins [BR:elgw03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     WGN25_06680 DNA repair and recombination proteins [BR:elgw03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       WGN25_06680 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Bac_DNA_binding HU-HIG HU-CCDC81_bac_2 PCuAC VWA_3 SasG_E TGS Motif Other DBs NCBI-ProteinID:  WYD86345 LinkDB All DBs Position complement(1463705..1464007) Genome browser AA seq 100 aa AA seqDB search MRTRKERKGIMNKKELVEAMAEAADISKSAAEKALNGMLMGITEALSEGDKVTLVGFGTF STAKRAARQAKNPQTGAVMEIPAKTVAKFKPGSKLSEAVK NT seq 303 nt NT seq  +upstreamnt  +downstreamnt attcgtactagaaaagagaggaaagggataatgaacaaaaaagaattggttgaggctatg gccgaagcagctgacatcagcaaatcagcagctgaaaaagcactcaatggtatgctgatg ggtattacagaagccctttccgaaggtgacaaggtcacactggtcggattcggcacattt tccacggctaagcgagcagcacgacaggcaaaaaatcctcaaacaggtgcagtcatggaa atccctgccaaaacagtggcgaaattcaagccaggcagcaagctctccgaggccgtcaaa tag

DBGET integrated database retrieval system