KEGG   Candidatus Electrothrix sp. GW3-4: WGN25_06805
Entry
WGN25_06805       CDS       T11264                                 
Name
(GenBank) ABC transporter substrate-binding protein/permease
  KO
K10036  glutamine transport system substrate-binding protein
K10037  glutamine transport system permease protein
Organism
elgw  Candidatus Electrothrix sp. GW3-4
Pathway
elgw02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:elgw00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    WGN25_06805
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:elgw02000]
    WGN25_06805
Transporters [BR:elgw02000]
 ABC transporters, prokaryotic type
  Phosphate and amino acid transporters
   Glutamine transporter
    WGN25_06805
SSDB
Motif
Pfam: SBP_bac_3 BPD_transp_1 Lig_chan-Glu_bd
Other DBs
NCBI-ProteinID: WYD85646
LinkDB
Position
1485929..1487377
AA seq 482 aa
MSKNPKGGTMHYARIILTLTLAFLALAGPWPAAAEEEFVTALTGKFPPFSYYDNQGNLAG
FDVDVSREIALRINRESRIIATEWDGILAGLLAEKYDAIIGSMAITPARQESVDFSAPYY
HSGAQLFVHRDNPDKVYSIEECKGLAVAVVLGETYQHYLEERFPDIEVVTLKSAAEIFAM
LEQKRITGFVTDRLVGAWQTKEAGRPFVPVGEMLYKERIGIPVRKDSPELLSQINTALAE
MEDDGTMQRIHQRYFGLGKTSSSTLGTMEPTVIATKLLKGFAVSLGIALAALLLGFALAI
PSGLLLTFQRGNLKPLHFLVRGFVDFIRGTPVLIQLLFVWLGLGLSPFPAAILTLGICAM
AYMAEVIRAGLMSVDPGQDLGARALGLSPLDRFRFVVWPQAFRIAIPPLMNCVVALLKDT
ALVSIISIPELIREAQSIISVTFEPGLYYLIAGLMFFAVTFPLMKLSDRVERSIKAKGFA
HD
NT seq 1449 nt   +upstreamnt  +downstreamnt
atgagtaagaacccaaaaggaggtacaatgcattatgcccggataatcctcaccctaacc
cttgccttccttgccctggcaggcccttggcccgcagcagccgaggaagaatttgtcacc
gccctgaccggcaagtttccccccttcagttattacgacaaccaagggaaccttgccggt
tttgacgtggacgtcagccgggaaatcgccctgcgcatcaaccgtgaatcccggatcatc
gccacggaatgggacggcatcctggcaggtctgctggcagagaaatacgacgccattatc
ggctcaatggccatcaccccggcccggcaggaaagcgtggatttttccgcgccctattac
cattcaggtgcccagctctttgtccaccgcgacaacccggacaaggtctactccattgag
gagtgcaagggattagccgttgccgtggtcctgggtgagacctaccagcattatctcgaa
gaaaggttcccggatattgaggtggtcaccctcaagtcagcagccgagatctttgccatg
ctggagcagaagcggatcactggctttgtcacggatcggctggtcggggcctggcagacc
aaggaggcgggccgtccctttgtgccggtgggcgagatgctctataaggagcgcatcggc
atcccggtgcgtaaggacagcccggagctgctcagccagatcaacacggccctggccgaa
atggaggatgacggcaccatgcagcgcatccaccagcgttatttcggtctgggcaagacc
tcctcttccacgctcggcaccatggaacccacggtgattgcgaccaagctgctcaagggc
tttgctgtcagtctcggcatcgcccttgctgcgctcctgctcggctttgccttggccatt
cccagcggcctgctgctgacctttcagcggggcaacctcaagccgctccattttttggtg
cggggctttgttgattttatccggggcacgcctgtgctgatccagctcctctttgtctgg
ctgggtctgggcttgtcgccttttccggccgccattctgaccctgggcatctgcgcaatg
gcttatatggccgaggttatccgggcaggcctgatgagtgttgatccaggccaggattta
ggcgcacgggccttgggactttctcccctggatcggtttcgctttgtggtctggcctcag
gccttccgcattgccatcccgcccttgatgaactgcgtagtggccctgctgaaagacacg
gccctggtctctattatttccatcccggagctgattcgcgaggcccagtccataatcagt
gtcacctttgaaccgggtctctactacctgatcgctggactcatgttctttgctgtgacc
ttcccgctgatgaagctctctgatcgcgttgaacgctccatcaaagccaaaggatttgcc
catgattga

DBGET integrated database retrieval system