Eubacterium limosum: B2M23_04665 Help Entry B2M23_04665       CDS       T06653                                  Name (GenBank) hypothetical protein   KO K03616   H+/Na+-translocating ferredoxin:NAD+ oxidoreductase subunit B [EC:7.1.1.11 7.2.1.2] Organism elim  Eubacterium limosum Brite KEGG Orthology (KO) [BR:elim00001]  09190 Not Included in Pathway or Brite   09191 Unclassified: metabolism    99980 Enzymes with EC numbers     B2M23_04665 Enzymes [BR:elim01000]  7. Translocases   7.1  Catalysing the translocation of protons    7.1.1  Linked to oxidoreductase reactions     7.1.1.11  ferredoxin---NAD+ oxidoreductase (H+-transporting)      B2M23_04665   7.2  Catalysing the translocation of inorganic cations    7.2.1  Linked to oxidoreductase reactions     7.2.1.2  ferredoxin---NAD+ oxidoreductase (Na+-transporting)      B2M23_04665 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FeS YhfH Motif Other DBs NCBI-ProteinID:  ARD64872 UniProt:  A0AAC9W2B3 LinkDB All DBs Position complement(1015637..1015831) Genome browser AA seq 64 aa AA seqDB search MEPIYPTDIYEYLPHSNCKRCGEDNCMAFADKLSKNEANLSSCAPLRLPEQEKNRKAVEK LLNS NT seq 195 nt NT seq  +upstreamnt  +downstreamnt atggaacctatctaccctaccgatatttatgaataccttcctcacagcaactgcaaacgc tgcggggaagacaactgcatggcttttgccgacaagctgtctaaaaatgaagccaatctc agcagctgcgccccgctccggcttcctgaacaggagaagaaccggaaagcggtggaaaaa ctgctgaatagctga

DBGET integrated database retrieval system