KEGG   Eubacterium limosum: B2M23_04840
Entry
B2M23_04840       CDS       T06653                                 
Name
(GenBank) methyltetrahydrofolate--corrinoid methyltransferase
  KO
K26930  [methyl-Co(III) quaternary-amine-specific corrinoid protein]---tetrahydrofolate methyltransferase [EC:2.1.1.389]
Organism
elim  Eubacterium limosum
Pathway
elim00670  One carbon pool by folate
Brite
KEGG Orthology (KO) [BR:elim00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    B2M23_04840
Enzymes [BR:elim01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.389  [methyl-Co(III) quaternary-amine-specific corrinoid protein]---tetrahydrofolate methyltransferase
     B2M23_04840
SSDB
Motif
Pfam: Pterin_bind CdhD
Other DBs
NCBI-ProteinID: ARD64907
UniProt: A0A317RJ24
LinkDB
Position
1046570..1047385
AA seq 271 aa
MIIIGEKLNGAIPVVKKAIEEKDEAFIRDRAIAQAEAGATYIDVCAGTAPEIELESLKWM
MDIVQEAVETPLCIDSPDPEILKAVFPLCKKPGLVNSVSGEGNKMDVLLPLFDDADPTWE
LVAMTCDNAGIPNTVEKKVELTKMMVEEAKKHNLTPNRIHIDPCVMALSTENHSFLNFKA
EIEGIREIYPDIHITSGLSNISFGLPARKLMNQNFMTLSMFVGMDSAVMDPTSRDMMGAI
FATDALLGNDRLCRKYSKAFRQGKIGPVQAK
NT seq 816 nt   +upstreamnt  +downstreamnt
atgattattattggagaaaaactgaacggtgcgattccagtggttaaaaaagccattgaa
gaaaaagacgaagcattcattagagacagagcaattgctcaggcagaagctggtgctacc
tacatcgacgtatgtgctggtacagctcctgaaattgaactggaatccttaaaatggatg
atggacattgtgcaggaagccgttgaaacaccactgtgtatcgacagcccggaccctgaa
attttaaaagctgttttcccattatgtaaaaaaccaggtctggtaaactctgtttccggc
gaaggtaacaaaatggatgttctcttaccattgtttgacgatgcagatccaacatgggaa
ctggttgctatgacttgtgataatgccggtattccaaacaccgttgaaaaaaaagttgag
ttaacaaaaatgatggttgaagaagctaaaaagcataatctgacaccaaacagaattcac
attgacccatgtgtaatggctttatcaacagaaaaccattctttcttaaacttcaaagca
gaaatcgaaggaatcagagaaatttatcctgacattcatattacctcaggcttaagtaac
atttctttcggcttaccagccagaaaattaatgaatcagaattttatgaccttatctatg
ttcgtaggtatggactccgctgttatggatccgacaagccgcgacatgatgggcgcaatt
ttcgcaacagacgctttattaggaaatgaccgactttgcagaaaatacagcaaggctttc
agacagggcaagattggaccagttcaggcgaaataa

DBGET integrated database retrieval system