Eubacterium limosum: B2M23_14445 Help Entry B2M23_14445       CDS       T06653                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism elim  Eubacterium limosum Pathway elim01100   Metabolic pathways elim01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:elim00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     B2M23_14445    00074 Mycolic acid biosynthesis     B2M23_14445   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     B2M23_14445 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF1493 Ribosomal_L12_N Ribosomal_L50 DUF7080 Motif Other DBs NCBI-ProteinID:  ARD66653 UniProt:  A0AAC9QW15 LinkDB All DBs Position 3095425..3095649 Genome browser AA seq 74 aa AA seqDB search MEEKFAKVQEIIAEQLELDPAKITMESSLMEDLEADSLDVIELVMAFEEEFGVKMPDEEL ENIKTVGDIVNALN NT seq 225 nt NT seq  +upstreamnt  +downstreamnt atggaagaaaaatttgcaaaagttcaggaaattatcgcggaacagctggagcttgatccg gcaaagatcaccatggaatcctctttgatggaggatctggaagcagactctctggacgtc attgagctggtcatggcctttgaggaagaattcggcgttaaaatgccggacgaagagctt gaaaatattaaaaccgttggtgatatcgtaaacgcactaaactaa

DBGET integrated database retrieval system