Elioraea tepida: KO353_09005 Help Entry KO353_09005       CDS       T07340                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism elio  Elioraea tepida Pathway elio01100   Metabolic pathways elio01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:elio00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     KO353_09005    00074 Mycolic acid biosynthesis     KO353_09005   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     KO353_09005 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 Ribosomal_L12_N Ribosomal_L50 Motif Other DBs NCBI-ProteinID:  QXM23473 UniProt:  A0A975U0G0 LinkDB All DBs Position complement(1870217..1870465) Genome browser AA seq 82 aa AA seqDB search MADTAEITRQVKEIVVEHLGVDEAKVTETASFIDDLGADSLDTVELVMAFEEKFGIEIPD DAAEKITTVKDAIDYIVKQKSA NT seq 249 nt NT seq  +upstreamnt  +downstreamnt atggccgacaccgcagagatcacgaggcaggtgaaggagatcgtcgtcgagcatctcggc gtcgatgaggcgaaggtgaccgagaccgcctccttcatcgacgatctcggcgcggacagt ctcgacaccgtcgagctcgtgatggccttcgaggagaagttcggcatcgagatccccgac gacgccgccgagaagatcaccaccgtcaaggacgcgatcgactacatcgtgaagcagaag tcggcctga

DBGET integrated database retrieval system