Elizabethkingia sp. M8: JCR23_07800 Help Entry JCR23_07800       CDS       T09429                                  Name (GenBank) HU family DNA-binding protein   KO K03530   DNA-binding protein HU-beta Organism eliz  Elizabethkingia sp. M8 Brite KEGG Orthology (KO) [BR:eliz00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:eliz03032]     JCR23_07800    03036 Chromosome and associated proteins [BR:eliz03036]     JCR23_07800    03400 DNA repair and recombination proteins [BR:eliz03400]     JCR23_07800 DNA replication proteins [BR:eliz03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     JCR23_07800 Chromosome and associated proteins [BR:eliz03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     JCR23_07800 DNA repair and recombination proteins [BR:eliz03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       JCR23_07800 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding HU-CCDC81_bac_2 HU-HIG FtsL_2 Motif Other DBs NCBI-ProteinID:  QQM28302 UniProt:  A0A7T7HFP7 LinkDB All DBs Position 1710756..1711043 Genome browser AA seq 95 aa AA seqDB search MNKSELIDAIAKDADITKVAAKKALESFISNVSSTLKKKDGKVSLVGFGTFSVAERAARQ GINPSTKKPIKIAAKKVAKFKAGSELAEAVNGKKK NT seq 288 nt NT seq  +upstreamnt  +downstreamnt atgaacaagtctgaattaatcgacgcaattgcaaaggatgctgatatcactaaagtagca gctaagaaagcattagaatctttcatctctaatgtatcttctacattgaagaaaaaagat ggtaaagtatctttagtaggtttcggaactttctccgtagctgaaagagctgctagacaa ggtatcaacccttctacaaagaaaccaattaaaatcgctgctaaaaaagtagctaaattt aaagctggttctgaattagcagaagctgtaaacggtaaaaagaaataa

DBGET integrated database retrieval system