Elizabethkingia sp. M8: JCR23_14670 Help Entry JCR23_14670       CDS       T09429                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism eliz  Elizabethkingia sp. M8 Pathway eliz01100   Metabolic pathways eliz01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:eliz00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     JCR23_14670    00074 Mycolic acid biosynthesis     JCR23_14670   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     JCR23_14670 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding ACP_SdgA_C Motif Other DBs NCBI-ProteinID:  QQM26092 LinkDB All DBs Position 3184743..3184964 Genome browser AA seq 73 aa AA seqDB search MEDFLEQIAEIMEVDSVNPSDELTSFEAWDSLTTLSIIALADDDYQVSLTNAEITDAKTI EGLHQLILSKQNA NT seq 222 nt NT seq  +upstreamnt  +downstreamnt atggaagattttttagaacaaatagcagagataatggaagtagatagtgttaatccttct gatgaacttacttcttttgaggcttgggactctttgacaacgttatcaattattgcattg gccgatgatgattatcaagtttcattaactaatgcagaaattaccgatgctaaaaccatt gagggtttacatcaattaatcctaagcaagcaaaatgcataa

DBGET integrated database retrieval system