KEGG   Enhydra lutris kenyoni (northern sea otter): 111158606
Entry
111158606         CDS       T05871                                 
Name
(RefSeq) calmodulin-like protein 3
  KO
K02183  calmodulin
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk04014  Ras signaling pathway
elk04015  Rap1 signaling pathway
elk04020  Calcium signaling pathway
elk04022  cGMP-PKG signaling pathway
elk04024  cAMP signaling pathway
elk04070  Phosphatidylinositol signaling system
elk04114  Oocyte meiosis
elk04218  Cellular senescence
elk04261  Adrenergic signaling in cardiomyocytes
elk04270  Vascular smooth muscle contraction
elk04371  Apelin signaling pathway
elk04625  C-type lectin receptor signaling pathway
elk04713  Circadian entrainment
elk04720  Long-term potentiation
elk04722  Neurotrophin signaling pathway
elk04728  Dopaminergic synapse
elk04740  Olfactory transduction
elk04744  Phototransduction
elk04750  Inflammatory mediator regulation of TRP channels
elk04910  Insulin signaling pathway
elk04912  GnRH signaling pathway
elk04915  Estrogen signaling pathway
elk04916  Melanogenesis
elk04921  Oxytocin signaling pathway
elk04922  Glucagon signaling pathway
elk04924  Renin secretion
elk04925  Aldosterone synthesis and secretion
elk04970  Salivary secretion
elk04971  Gastric acid secretion
elk05010  Alzheimer disease
elk05012  Parkinson disease
elk05022  Pathways of neurodegeneration - multiple diseases
elk05031  Amphetamine addiction
elk05034  Alcoholism
elk05133  Pertussis
elk05152  Tuberculosis
elk05163  Human cytomegalovirus infection
elk05167  Kaposi sarcoma-associated herpesvirus infection
elk05170  Human immunodeficiency virus 1 infection
elk05200  Pathways in cancer
elk05214  Glioma
elk05417  Lipid and atherosclerosis
elk05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:elk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    111158606
   04015 Rap1 signaling pathway
    111158606
   04371 Apelin signaling pathway
    111158606
   04020 Calcium signaling pathway
    111158606
   04070 Phosphatidylinositol signaling system
    111158606
   04024 cAMP signaling pathway
    111158606
   04022 cGMP-PKG signaling pathway
    111158606
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    111158606
   04218 Cellular senescence
    111158606
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    111158606
  09152 Endocrine system
   04910 Insulin signaling pathway
    111158606
   04922 Glucagon signaling pathway
    111158606
   04912 GnRH signaling pathway
    111158606
   04915 Estrogen signaling pathway
    111158606
   04921 Oxytocin signaling pathway
    111158606
   04916 Melanogenesis
    111158606
   04924 Renin secretion
    111158606
   04925 Aldosterone synthesis and secretion
    111158606
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    111158606
   04270 Vascular smooth muscle contraction
    111158606
  09154 Digestive system
   04970 Salivary secretion
    111158606
   04971 Gastric acid secretion
    111158606
  09156 Nervous system
   04728 Dopaminergic synapse
    111158606
   04720 Long-term potentiation
    111158606
   04722 Neurotrophin signaling pathway
    111158606
  09157 Sensory system
   04744 Phototransduction
    111158606
   04740 Olfactory transduction
    111158606
   04750 Inflammatory mediator regulation of TRP channels
    111158606
  09159 Environmental adaptation
   04713 Circadian entrainment
    111158606
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111158606
  09162 Cancer: specific types
   05214 Glioma
    111158606
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    111158606
   05163 Human cytomegalovirus infection
    111158606
   05167 Kaposi sarcoma-associated herpesvirus infection
    111158606
  09171 Infectious disease: bacterial
   05133 Pertussis
    111158606
   05152 Tuberculosis
    111158606
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    111158606
   05012 Parkinson disease
    111158606
   05022 Pathways of neurodegeneration - multiple diseases
    111158606
  09165 Substance dependence
   05031 Amphetamine addiction
    111158606
   05034 Alcoholism
    111158606
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    111158606
   05418 Fluid shear stress and atherosclerosis
    111158606
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:elk01009]
    111158606
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:elk04131]
    111158606
   03036 Chromosome and associated proteins [BR:elk03036]
    111158606
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:elk04147]
    111158606
Protein phosphatases and associated proteins [BR:elk01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     111158606
Membrane trafficking [BR:elk04131]
 Exocytosis
  Small GTPases and associated proteins
   Rab associated proteins
    111158606
Chromosome and associated proteins [BR:elk03036]
 Eukaryotic type
  Centrosome formation proteins
   Centrosome duplication proteins
    Centriole replication proteins
     111158606
Exosome [BR:elk04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   111158606
SSDB
Motif
Pfam: EF-hand_1 EF-hand_7 EF-hand_6 EF-hand_8 EF-hand_5 EF-hand_9 AIF-1 SPARC_Ca_bdg UPF0154 EF_EFCAB10_C EH Dockerin_1 Temptin_C DUF5580_M EF-hand_11 Caleosin DUF1103 SurA_N_3 Fe_hyd_lg_C EFhand_Ca_insen
Other DBs
NCBI-GeneID: 111158606
NCBI-ProteinID: XP_022376452
UniProt: A0A2Y9KR42
LinkDB
Position
Unknown
AA seq 149 aa
MADQLREEQVAEFKEAFCLFDKDGDGVITTQELGTVMRSLGQNPTEAELRDMVSEIDRDG
NGTVDFPEFLGMMARQLKGRDNEDQIREAFRVFDKDGNGLVSAAELRHVMTRLGEKLSNE
EVDEMIRAADVDGDGQVNYEEFVHMLVSK
NT seq 450 nt   +upstreamnt  +downstreamnt
atggctgaccagttacgtgaggaacaggtggccgagttcaaggaggccttctgcctgttt
gacaaggacggggacggcgtcatcaccacccaggagctgggcaccgtcatgcgctccctg
ggccagaaccccacggaggctgagctgcgggacatggtaagcgagattgaccgcgacggc
aacggcaccgtggacttccccgagttcctgggcatgatggccaggcagctgaagggcagg
gacaatgaggaccagatccgcgaggccttccgcgtcttcgacaaggacggcaacggcctg
gtgagcgccgctgagctgcggcatgtgatgaccaggctgggggagaagctgagcaacgag
gaggtggacgagatgatccgggccgcagacgtggacggggacgggcaggtgaactacgag
gagttcgtccacatgctggtctccaagtga

DBGET integrated database retrieval system