KEGG   Enhydra lutris kenyoni (northern sea otter): 111162236
Entry
111162236         CDS       T05871                                 
Name
(RefSeq) LOW QUALITY PROTEIN: mitogen-activated protein kinase 3
  KO
K04371  mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk01521  EGFR tyrosine kinase inhibitor resistance
elk01522  Endocrine resistance
elk01524  Platinum drug resistance
elk04010  MAPK signaling pathway
elk04012  ErbB signaling pathway
elk04014  Ras signaling pathway
elk04015  Rap1 signaling pathway
elk04022  cGMP-PKG signaling pathway
elk04024  cAMP signaling pathway
elk04062  Chemokine signaling pathway
elk04066  HIF-1 signaling pathway
elk04068  FoxO signaling pathway
elk04071  Sphingolipid signaling pathway
elk04072  Phospholipase D signaling pathway
elk04114  Oocyte meiosis
elk04140  Autophagy - animal
elk04148  Efferocytosis
elk04150  mTOR signaling pathway
elk04151  PI3K-Akt signaling pathway
elk04210  Apoptosis
elk04218  Cellular senescence
elk04261  Adrenergic signaling in cardiomyocytes
elk04270  Vascular smooth muscle contraction
elk04350  TGF-beta signaling pathway
elk04360  Axon guidance
elk04370  VEGF signaling pathway
elk04371  Apelin signaling pathway
elk04380  Osteoclast differentiation
elk04510  Focal adhesion
elk04520  Adherens junction
elk04540  Gap junction
elk04550  Signaling pathways regulating pluripotency of stem cells
elk04611  Platelet activation
elk04613  Neutrophil extracellular trap formation
elk04620  Toll-like receptor signaling pathway
elk04621  NOD-like receptor signaling pathway
elk04625  C-type lectin receptor signaling pathway
elk04650  Natural killer cell mediated cytotoxicity
elk04657  IL-17 signaling pathway
elk04658  Th1 and Th2 cell differentiation
elk04659  Th17 cell differentiation
elk04660  T cell receptor signaling pathway
elk04662  B cell receptor signaling pathway
elk04664  Fc epsilon RI signaling pathway
elk04666  Fc gamma R-mediated phagocytosis
elk04668  TNF signaling pathway
elk04713  Circadian entrainment
elk04720  Long-term potentiation
elk04722  Neurotrophin signaling pathway
elk04723  Retrograde endocannabinoid signaling
elk04724  Glutamatergic synapse
elk04725  Cholinergic synapse
elk04726  Serotonergic synapse
elk04730  Long-term depression
elk04810  Regulation of actin cytoskeleton
elk04910  Insulin signaling pathway
elk04912  GnRH signaling pathway
elk04914  Progesterone-mediated oocyte maturation
elk04915  Estrogen signaling pathway
elk04916  Melanogenesis
elk04917  Prolactin signaling pathway
elk04919  Thyroid hormone signaling pathway
elk04921  Oxytocin signaling pathway
elk04926  Relaxin signaling pathway
elk04928  Parathyroid hormone synthesis, secretion and action
elk04929  GnRH secretion
elk04930  Type II diabetes mellitus
elk04933  AGE-RAGE signaling pathway in diabetic complications
elk04934  Cushing syndrome
elk04935  Growth hormone synthesis, secretion and action
elk04960  Aldosterone-regulated sodium reabsorption
elk05010  Alzheimer disease
elk05020  Prion disease
elk05022  Pathways of neurodegeneration - multiple diseases
elk05034  Alcoholism
elk05132  Salmonella infection
elk05133  Pertussis
elk05135  Yersinia infection
elk05140  Leishmaniasis
elk05142  Chagas disease
elk05145  Toxoplasmosis
elk05152  Tuberculosis
elk05160  Hepatitis C
elk05161  Hepatitis B
elk05163  Human cytomegalovirus infection
elk05164  Influenza A
elk05165  Human papillomavirus infection
elk05166  Human T-cell leukemia virus 1 infection
elk05167  Kaposi sarcoma-associated herpesvirus infection
elk05170  Human immunodeficiency virus 1 infection
elk05171  Coronavirus disease - COVID-19
elk05200  Pathways in cancer
elk05203  Viral carcinogenesis
elk05205  Proteoglycans in cancer
elk05206  MicroRNAs in cancer
elk05207  Chemical carcinogenesis - receptor activation
elk05208  Chemical carcinogenesis - reactive oxygen species
elk05210  Colorectal cancer
elk05211  Renal cell carcinoma
elk05212  Pancreatic cancer
elk05213  Endometrial cancer
elk05214  Glioma
elk05215  Prostate cancer
elk05216  Thyroid cancer
elk05218  Melanoma
elk05219  Bladder cancer
elk05220  Chronic myeloid leukemia
elk05221  Acute myeloid leukemia
elk05223  Non-small cell lung cancer
elk05224  Breast cancer
elk05225  Hepatocellular carcinoma
elk05226  Gastric cancer
elk05230  Central carbon metabolism in cancer
elk05231  Choline metabolism in cancer
elk05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
elk05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:elk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    111162236
   04012 ErbB signaling pathway
    111162236
   04014 Ras signaling pathway
    111162236
   04015 Rap1 signaling pathway
    111162236
   04350 TGF-beta signaling pathway
    111162236
   04370 VEGF signaling pathway
    111162236
   04371 Apelin signaling pathway
    111162236
   04668 TNF signaling pathway
    111162236
   04066 HIF-1 signaling pathway
    111162236
   04068 FoxO signaling pathway
    111162236
   04072 Phospholipase D signaling pathway
    111162236
   04071 Sphingolipid signaling pathway
    111162236
   04024 cAMP signaling pathway
    111162236
   04022 cGMP-PKG signaling pathway
    111162236
   04151 PI3K-Akt signaling pathway
    111162236
   04150 mTOR signaling pathway
    111162236
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    111162236
   04148 Efferocytosis
    111162236
  09143 Cell growth and death
   04114 Oocyte meiosis
    111162236
   04210 Apoptosis
    111162236
   04218 Cellular senescence
    111162236
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    111162236
   04520 Adherens junction
    111162236
   04540 Gap junction
    111162236
   04550 Signaling pathways regulating pluripotency of stem cells
    111162236
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    111162236
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    111162236
   04613 Neutrophil extracellular trap formation
    111162236
   04620 Toll-like receptor signaling pathway
    111162236
   04621 NOD-like receptor signaling pathway
    111162236
   04625 C-type lectin receptor signaling pathway
    111162236
   04650 Natural killer cell mediated cytotoxicity
    111162236
   04660 T cell receptor signaling pathway
    111162236
   04658 Th1 and Th2 cell differentiation
    111162236
   04659 Th17 cell differentiation
    111162236
   04657 IL-17 signaling pathway
    111162236
   04662 B cell receptor signaling pathway
    111162236
   04664 Fc epsilon RI signaling pathway
    111162236
   04666 Fc gamma R-mediated phagocytosis
    111162236
   04062 Chemokine signaling pathway
    111162236
  09152 Endocrine system
   04910 Insulin signaling pathway
    111162236
   04929 GnRH secretion
    111162236
   04912 GnRH signaling pathway
    111162236
   04915 Estrogen signaling pathway
    111162236
   04914 Progesterone-mediated oocyte maturation
    111162236
   04917 Prolactin signaling pathway
    111162236
   04921 Oxytocin signaling pathway
    111162236
   04926 Relaxin signaling pathway
    111162236
   04935 Growth hormone synthesis, secretion and action
    111162236
   04919 Thyroid hormone signaling pathway
    111162236
   04928 Parathyroid hormone synthesis, secretion and action
    111162236
   04916 Melanogenesis
    111162236
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    111162236
   04270 Vascular smooth muscle contraction
    111162236
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    111162236
  09156 Nervous system
   04724 Glutamatergic synapse
    111162236
   04725 Cholinergic synapse
    111162236
   04726 Serotonergic synapse
    111162236
   04720 Long-term potentiation
    111162236
   04730 Long-term depression
    111162236
   04723 Retrograde endocannabinoid signaling
    111162236
   04722 Neurotrophin signaling pathway
    111162236
  09158 Development and regeneration
   04360 Axon guidance
    111162236
   04380 Osteoclast differentiation
    111162236
  09159 Environmental adaptation
   04713 Circadian entrainment
    111162236
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111162236
   05206 MicroRNAs in cancer
    111162236
   05205 Proteoglycans in cancer
    111162236
   05207 Chemical carcinogenesis - receptor activation
    111162236
   05208 Chemical carcinogenesis - reactive oxygen species
    111162236
   05203 Viral carcinogenesis
    111162236
   05230 Central carbon metabolism in cancer
    111162236
   05231 Choline metabolism in cancer
    111162236
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    111162236
  09162 Cancer: specific types
   05210 Colorectal cancer
    111162236
   05212 Pancreatic cancer
    111162236
   05225 Hepatocellular carcinoma
    111162236
   05226 Gastric cancer
    111162236
   05214 Glioma
    111162236
   05216 Thyroid cancer
    111162236
   05221 Acute myeloid leukemia
    111162236
   05220 Chronic myeloid leukemia
    111162236
   05218 Melanoma
    111162236
   05211 Renal cell carcinoma
    111162236
   05219 Bladder cancer
    111162236
   05215 Prostate cancer
    111162236
   05213 Endometrial cancer
    111162236
   05224 Breast cancer
    111162236
   05223 Non-small cell lung cancer
    111162236
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    111162236
   05170 Human immunodeficiency virus 1 infection
    111162236
   05161 Hepatitis B
    111162236
   05160 Hepatitis C
    111162236
   05171 Coronavirus disease - COVID-19
    111162236
   05164 Influenza A
    111162236
   05163 Human cytomegalovirus infection
    111162236
   05167 Kaposi sarcoma-associated herpesvirus infection
    111162236
   05165 Human papillomavirus infection
    111162236
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    111162236
   05135 Yersinia infection
    111162236
   05133 Pertussis
    111162236
   05152 Tuberculosis
    111162236
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    111162236
   05140 Leishmaniasis
    111162236
   05142 Chagas disease
    111162236
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    111162236
   05020 Prion disease
    111162236
   05022 Pathways of neurodegeneration - multiple diseases
    111162236
  09165 Substance dependence
   05034 Alcoholism
    111162236
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    111162236
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    111162236
   04933 AGE-RAGE signaling pathway in diabetic complications
    111162236
   04934 Cushing syndrome
    111162236
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    111162236
   01524 Platinum drug resistance
    111162236
   01522 Endocrine resistance
    111162236
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:elk01001]
    111162236
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:elk03036]
    111162236
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:elk04147]
    111162236
Enzymes [BR:elk01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     111162236
Protein kinases [BR:elk01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   111162236
Chromosome and associated proteins [BR:elk03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Protein kinases
     111162236
Exosome [BR:elk04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   111162236
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr ABC1 APH Haspin_kinase FTA2 Kdo
Other DBs
NCBI-GeneID: 111162236
NCBI-ProteinID: XP_022382213
UniProt: A0A2Y9LAC7
LinkDB
Position
Unknown
AA seq 372 aa
MAAGAARGGGGGXGPGVSGEVEVVKGQPFDVGPRYTELHYIGEGAYGMVSSAYDHVRKIR
VAIKKISPFEHQTYCQRTLREIQILLRFRHENVIGIRDILRAPTLEAMRDVYIVQDLMET
DLYKLLKSQQLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLINTTCDLKICDFGL
ARIADPEHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPG
KHYLDQLNHILGILGSPSQEDLNCIINMKARNYLQSLPSKTKVAWAKLFPKSDSKALDLL
DRMLTFNPNKRITVEEALAHPYLEQYYDPSDEPVAEEPFTFDMELDDLPKERLKELIFQE
TARFQPGALEAP
NT seq 1119 nt   +upstreamnt  +downstreamnt
atggcggcgggggcggcccgggggggcgggggggggnngggcccgggggtctcgggggag
gtggaggtagtgaaggggcagccgttcgacgtgggcccacgctacacggagctgcattac
atcggcgagggcgcgtacggcatggtcagctcagcttacgaccacgtgcgcaagattcgc
gtggccatcaagaaaatcagccccttcgagcatcagacctactgccagcgcacactgcga
gagatccagatcttactgcgcttccgccacgagaacgtcattggcattcgggatattctg
cgggcgcccaccctggaagccatgagggatgtctacattgtgcaggacctgatggagact
gacctctacaaactgctcaaaagccagcagctgagcaacgaccatatctgctacttcctc
taccagatcctgcggggccttaagtatatccactcggccaacgtgctccaccgggattta
aagccctctaacctgctcatcaacaccacctgcgaccttaagatctgcgattttggactg
gcccggattgccgatcccgagcacgaccacactggcttcctgacagagtatgtggccaca
cgctggtaccgggctccagaaatcatgcttaactctaagggctacaccaagtccatcgac
atctggtctgtgggctgcattctggctgagatgctctccaaccggcccatcttccctggc
aagcactacctggaccagctcaaccacattctgggtatcctgggctccccatcccaggag
gacttgaactgtatcatcaacatgaaggcccggaactatctgcagtctctgccctccaag
accaaggtggcctgggccaagcttttccccaagtcagactccaaagcccttgacctgcta
gaccggatgctgaccttcaaccccaacaaacgaatcacagtggaagaagccctggctcac
ccctacttggagcagtactacgacccaagtgatgagccagtggccgaggagcctttcacc
ttcgacatggagctggatgacctacccaaggagcggctgaaggagctcatcttccaggag
acagcccgcttccagcctggggcgctggaggccccctaa

DBGET integrated database retrieval system