Escherichia coli W: WFL_05310 Help Entry WFL_05310         CDS       T02101                                  Name (GenBank) hypothetical protein   KO K22501   cytochrome bd-II ubiquinol oxidase subunit AppX [EC:7.1.1.7] Organism ell  Escherichia coli W Pathway ell00190   Oxidative phosphorylation ell01100   Metabolic pathways ell02020   Two-component system Module ell_M00153   Cytochrome bd ubiquinol oxidase Brite KEGG Orthology (KO) [BR:ell00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     WFL_05310  09130 Environmental Information Processing   09132 Signal transduction    02020 Two-component system     WFL_05310 Enzymes [BR:ell01000]  7. Translocases   7.1  Catalysing the translocation of protons    7.1.1  Linked to oxidoreductase reactions     7.1.1.7  quinol oxidase (electrogenic, proton-motive force generating)      WFL_05310 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  YbgT_YccB Adeno_E3B Motif Other DBs NCBI-ProteinID:  AFH10726 UniProt:  E0IZ63 LinkDB All DBs Position 1146344..1146436 Genome browser AA seq 30 aa AA seqDB search MWYLLWFVGILLMCSLSTLVLVWLDPRLKS NT seq 93 nt NT seq  +upstreamnt  +downstreamnt atgtggtatttactttggttcgtcggcattttgttgatgtgttcgctctccacccttgtg ttggtatggctggacccgcgtctgaaaagttaa

DBGET integrated database retrieval system