Escherichia coli W: WFL_23905 Help Entry WFL_23905         CDS       T02101                                  Name (GenBank) hypothetical protein   KO K12149   DNA-damage-inducible protein I Organism ell  Escherichia coli W Brite KEGG Orthology (KO) [BR:ell00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03400 DNA repair and recombination proteins [BR:ell03400]     WFL_23905 DNA repair and recombination proteins [BR:ell03400]  Prokaryotic type   TLS (translesion DNA synthesis) factors    Other SOS response factors     WFL_23905 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  DinI RWD Motif Other DBs NCBI-ProteinID:  AFH14373 UniProt:  E0J3B3 LinkDB All DBs Position pRK1:complement(89846..90094) Genome browser AA seq 82 aa AA seqDB search MIRIEILFDRQNTKNLKSGTLQALQNEIEQRLKPHYPEIWLRIDQGSAPSVSVTGARNDK DKERILSLLEEIWQDDSWLPAA NT seq 249 nt NT seq  +upstreamnt  +downstreamnt atgatccgcattgaaattcttttcgaccgccagaacacaaaaaacctcaaatcaggcaca cttcaggcgctacagaatgaaatcgaacaacgtctgaaaccacactacccggaaatctgg ctgcgtatagaccagggcagcgccccgtctgtatctgtcacaggagcccgcaacgacaag gataaagaacgtatcctgtctctgctggaagaaatctggcaggacgacagctggctgcct gcagcatga

DBGET integrated database retrieval system