Escherichia coli O83 H1 NRG 857C (AIEC): NRG857_03270 Help Entry NRG857_03270      CDS       T02068                                  Name (GenBank) hypothetical protein   KO K00424   cytochrome bd-I ubiquinol oxidase subunit X [EC:7.1.1.7] Organism eln  Escherichia coli O83:H1 NRG 857C (AIEC) Pathway eln00190   Oxidative phosphorylation eln01100   Metabolic pathways eln02020   Two-component system Module eln_M00153   Cytochrome bd ubiquinol oxidase Brite KEGG Orthology (KO) [BR:eln00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     NRG857_03270  09130 Environmental Information Processing   09132 Signal transduction    02020 Two-component system     NRG857_03270 Enzymes [BR:eln01000]  7. Translocases   7.1  Catalysing the translocation of protons    7.1.1  Linked to oxidoreductase reactions     7.1.1.7  quinol oxidase (electrogenic, proton-motive force generating)      NRG857_03270 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  YbgT_YccB Motif Other DBs NCBI-ProteinID:  ADR26085 UniProt:  A0A0H3EEQ5 LinkDB All DBs Position 723032..723145 Genome browser AA seq 37 aa AA seqDB search MWYFAWILGTLLACSFGVITALALEHVESGKAGQEDI NT seq 114 nt NT seq  +upstreamnt  +downstreamnt atgtggtatttcgcatggattctgggaacgcttcttgcctgttcgtttggggtaatcacc gcgctggcgcttgagcacgtcgaatcaggcaaagccggtcaagaagacatctga

DBGET integrated database retrieval system