KEGG   Escherichia coli O83 H1 NRG 857C (AIEC): NRG857_15710
Entry
NRG857_15710      CDS       T02068                                 
Symbol
truB
Name
(GenBank) tRNA pseudouridine synthase B
  KO
K03177  tRNA pseudouridine55 synthase [EC:5.4.99.25]
Organism
eln  Escherichia coli O83:H1 NRG 857C (AIEC)
Brite
KEGG Orthology (KO) [BR:eln00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:eln03016]
    NRG857_15710 (truB)
Enzymes [BR:eln01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.25  tRNA pseudouridine55 synthase
     NRG857_15710 (truB)
Transfer RNA biogenesis [BR:eln03016]
 Eukaryotic type
  tRNA modification factors
   Psudouridine synthases
    NRG857_15710 (truB)
 Prokaryotic type
    NRG857_15710 (truB)
SSDB
Motif
Pfam: TruB_N TruB-C_2 TruB_C_2
Other DBs
NCBI-ProteinID: ADR28552
UniProt: A0A0H3EP46
LinkDB
Position
complement(3329883..3330827)
AA seq 314 aa
MSRPRRRGRDINGVLLLDKPQGMSSNDALQKVKRIYNANRAGHTGALDPLATGMLPICLG
EATKFSQYLLDSDKRYRVIARLGQRTDTSDADGQIVEERPVTFSAEQLAAALDTFRGDIE
QIPSMYSALKYQGKKLYEYARQGIEVPREARPITVYELLFIRHEGNELELEIHCSKGTYI
RTIIDDLGEKLGCGAHVIYLRRLAVSKYPVERMVTLEHLRELVEQAEQQDIPAAELLDPL
LMPMDSPASDYPVVNLPLTSSVYFKNGNPVRTSGAPLEGLVRVTEGENGKFIGMGEIDDE
GRVAPRRLVVEYPA
NT seq 945 nt   +upstreamnt  +downstreamnt
atgagtcgtcctcgtcgtcgcggtcgcgacattaacggcgttttgttgctggataaaccg
caggggatgtccagcaacgatgcgctgcaaaaagtgaaacggatttataacgccaaccgt
gccgggcataccggtgcgctggacccgctggcgaccggcatgttgccaatttgcctcggg
gaagcgacgaagttttcccagtatctgctggactccgacaaacgctatcgggtcattgcg
cgtcttggacagcgtaccgatacttctgatgccgacggacaaatcgttgaagaacgtccg
gtaacctttagtgcagagcaactggcggcggcgctggataccttccgtggcgatatcgaa
cagatcccttcgatgtattcagcactgaaatatcagggcaaaaaactgtacgaatacgcg
cgtcagggcattgaagttccgcgtgaagcgcgcccgattaccgtttatgaattgctgttt
attcgccatgaaggcaatgagctggagctggaaattcactgctcaaaaggcacttatatc
cgcactatcattgacgatctcggcgaaaaactcggttgtggcgcgcatgttatttacttg
cgtcgtctggcggtaagtaaatatccggttgaacggatggtgaccctggaacatctgcgt
gaactggttgagcaagccgaacagcaggatattccggctgcggagttacttgatccatta
ctgatgccaatggacagtccagcttcggactacccagtggtgaatcttccgttaacgtct
tctgtttacttcaaaaatggtaacccagttcgtacatccggtgcgccgctggaaggactg
gttcgcgttacagagggtgagaacggcaagtttatcggtatgggcgaaattgacgatgaa
ggccgcgttgcgcctcgtcgcctggtggttgaatacccggcgtaa

DBGET integrated database retrieval system