Escherichia coli O44 H18 042 (EAEC): EC042_1164 Help Entry EC042_1164        CDS       T02067                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism elo  Escherichia coli O44:H18 042 (EAEC) Pathway elo01100   Metabolic pathways elo01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:elo00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     EC042_1164 (acpP)    00074 Mycolic acid biosynthesis     EC042_1164 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     EC042_1164 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 ACP_SdgA_C DUF1896 TerB HLH Motif Other DBs NCBI-ProteinID:  CBG33982 UniProt:  D3H198 LinkDB All DBs Position 1244036..1244272 Genome browser AA seq 78 aa AA seqDB search MSTIEERVKKIIGEQLGVKQEEVTNNASFVEDLGADSLDTVELVMALEEEFDTEIPDEEA EKITTVQAAIDYINGHQA NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcactatcgaagaacgcgttaagaaaattatcggcgaacagctgggcgttaagcag gaagaagttaccaacaatgcttctttcgttgaagacctgggcgcggattctcttgacacc gttgagctggtaatggctctggaagaagagtttgatactgagattccggacgaagaagct gagaaaatcaccaccgttcaggctgccattgattacatcaacggccaccaggcgtaa

DBGET integrated database retrieval system