KEGG   Escherichia coli O44 H18 042 (EAEC): EC042_2277
Entry
EC042_2277        CDS       T02067                                 

Gene name
wbaD
Definition
(GenBank) putative glycosyltransferase
  KO
K23202  O17/O44/073/077/0106-antigen biosynthesis mannosyltransferase
Organism
elo  Escherichia coli O44:H18 042 (EAEC)
Pathway
elo00542  O-Antigen repeat unit biosynthesis
Brite
KEGG Orthology (KO) [BR:elo00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00542 O-Antigen repeat unit biosynthesis
    EC042_2277 (wbaD)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01005 Lipopolysaccharide biosynthesis proteins [BR:elo01005]
    EC042_2277 (wbaD)
Lipopolysaccharide biosynthesis proteins [BR:elo01005]
 O-antigen repeat unit
  EC042_2277 (wbaD)
SSDB
Motif
Pfam: Glyco_trans_1_4 Glyco_trans_1_2 Glycos_transf_1
Other DBs
NCBI-ProteinID: CBG35111
UniProt: D3GZA2
LinkDB
Position
complement(2372931..2374133)
AA seq 400 aa
MSNIDINKKQILVLTPRFPFPVIGGDRLRIYKICKELSKHYDLTLLSLCDKREELNYEYD
REVFSSVHRVYLSKKKSILNVIFSLFSNTPLQIGYYKSKEFEDKLKQLLPEHSATLSHLI
RVGDYVKENKDINFLEMTDAISLNYKRVKEKASLLSLKTFVYSFEQKRLERYERTINNKF
SLTTLVSQVDSDYLYPDRPNNVLVCGNGVDAVSLPFSERKIAKDKKITLVFIGNLYSLQN
MDGVRWFTKEVLPFLNKHGNFEFKVIGRITDKDKSWLESQPGVVVTGEVDSITYAAADGH
IGVCPIRLGAGIQNKVLEYMALGLPCISSTVGFEGLGAEEGKEIYVANTKEEYLRVLNYF
ITNLDKYTETALVAKKFIGENFSWEAKLSPYIQKIKESVK
NT seq 1203 nt   +upstreamnt  +downstreamnt
atgagtaatattgatataaataagaaacagatattagttttgactccacggttcccgttt
cctgtcattggtggggatcgattacgtatctataagatctgtaaagaactgtctaagcat
tatgatcttacgttgctgagtctgtgtgataaacgcgaagagctcaactatgaatatgat
cgtgaagtttttagtagtgttcacagagtatatctttcaaagaaaaaatctattttaaat
gtcatattctctttgttttcaaatactcccctacagattgggtattataaatctaaagaa
tttgaagataaacttaagcagttattacctgaacattctgcaactctttcacatttgata
agggttggtgattatgtgaaagagaataaagatataaattttttagagatgaccgatgcc
atttcacttaattataaacgagtaaaggaaaaagcatctttattgagtttaaaaacattt
gtatattcttttgaacaaaaaagactcgaacgatatgagcgaactataaataacaagttc
agcttgactactttggtatcacaggttgactccgattatttatatccagaccgtccgaat
aatgtattagtctgtggaaatggtgttgatgccgttagcttacctttttcagaacgaaaa
atagctaaagataaaaagataacccttgtatttataggtaatttatattctttgcaaaat
atggatggtgtgagatggttcaccaaggaagttttaccatttcttaacaagcatggtaat
tttgaatttaaggtcatcggacgtattacagataaagataagagttggttagaaagccag
cctggcgttgttgtcacaggtgaagttgatagcataacttatgcagcagctgatgggcat
attggtgtatgtcctattagattaggggcaggtatccaaaataaggtacttgaatatatg
gcgttgggattaccttgtatctcttctactgtaggctttgaaggcttgggagcagaggag
ggtaaggagatttatgttgccaatacaaaagaagaatatttacgtgtattaaattatttt
ataacaaatctggataaatataccgaaacagcattagttgcgaaaaagtttatcggtgag
aatttttcatgggaagctaaattgagcccatatatccagaaaattaaggagtctgttaaa
taa

DBGET integrated database retrieval system