KEGG   Escherichia coli O44 H18 042 (EAEC): EC042_2278
Entry
EC042_2278        CDS       T02067                                 

Symbol
wbaC
Name
(GenBank) putative glycosyltransferase
  KO
K23201  O17/O44/073/077/0106-antigen biosynthesis mannosyltransferase
Organism
elo  Escherichia coli O44:H18 042 (EAEC)
Pathway
elo00542  O-Antigen repeat unit biosynthesis
Brite
KEGG Orthology (KO) [BR:elo00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00542 O-Antigen repeat unit biosynthesis
    EC042_2278 (wbaC)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01005 Lipopolysaccharide biosynthesis proteins [BR:elo01005]
    EC042_2278 (wbaC)
Lipopolysaccharide biosynthesis proteins [BR:elo01005]
 O-antigen repeat unit
  EC042_2278 (wbaC)
SSDB
Motif
Pfam: Glycos_transf_1 Glyco_trans_1_4
Other DBs
NCBI-ProteinID: CBG35112
UniProt: D3GZA3
LinkDB
Position
complement(2374126..2375163)
AA seq 345 aa
MIISEINLRANMKVIVNNFFDGILKRGIPIYTSELVQKLRDNNVQVIYVACPKAFHKLPS
WFLNVLFIIVEQLLIPIMGIFYRTKYNIYPYNSSSIIDLLLGKAIVIIHDFISLKKNKRN
LAAIYVKVCIYFSSFLAKKVIFISQSTQRVSKRISLFKCIESILLPNPFFSFEKIANVTE
IKDLGYLLLVSGLGDNKDLGTALDYYFSIPREERIPLKILGCGNGISKVNDLIDGRDTDK
EIEIIGFVSLEEVVKLYCNSKIVWAHSLAEGYGRTLAEAKLTCKNVICTRISAFREQKDS
NIFFYTYYSEYYEVYSYLVDNSPSVERKALHEHILFENELRKIYE
NT seq 1038 nt   +upstreamnt  +downstreamnt
ttgataatatctgaaataaacttaagagcaaacatgaaagtaattgtaaataattttttt
gatggtattttgaaaagaggaataccgatctatacttctgaacttgtgcaaaagttaaga
gacaataatgttcaggttatttatgttgcatgtccaaaagcattccataagctgccttca
tggtttctgaatgttctttttataatagtagagcagcttttaataccaattatgggtata
ttttatagaactaagtataatatatatccctataatagtagttccatcattgacttgtta
ttaggtaaggcaattgttataattcatgacttcattagtcttaagaaaaataaacgaaat
cttgctgccatttatgtgaaagtctgtatttatttttcatcttttttagcaaagaaagta
atatttatttctcaaagcactcagcgagtatctaagagaatatcgctatttaagtgtata
gaatctatcctgctcccaaatccatttttctcatttgagaaaattgctaatgttaccgaa
ataaaagatcttggatatttacttctagtttcaggtttaggggataataaggatctaggc
acagctctggactattatttttcaatcccaagggaagaaagaataccattaaaaatatta
ggttgtgggaatggtattagcaaggttaacgacttaattgatgggcgggatacagataaa
gaaattgaaattattggttttgtttctttagaggaagtcgtcaaactatattgtaattct
aaaattgtttgggctcattcgcttgccgaggggtatggaaggactttagctgaagcaaaa
ctcacatgcaaaaatgttatatgcacacggatctctgctttccgcgaacaaaaggattcg
aatattttcttttatacttactattctgagtattatgaagtctattcatacttggtagat
aattcacccagtgtcgaaaggaaagctctgcatgaacatattttatttgaaaatgaattg
agaaagatttatgagtaa

DBGET integrated database retrieval system