Escherichia coli O44 H18 042 (EAEC): EC042_3267 Help Entry EC042_3267        CDS       T02067                                  Name (GenBank) putative acyl carrier protein   KO K02078   acyl carrier protein Organism elo  Escherichia coli O44:H18 042 (EAEC) Pathway elo01100   Metabolic pathways elo01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:elo00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     EC042_3267    00074 Mycolic acid biosynthesis     EC042_3267   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     EC042_3267 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding DUF1493 BH4 Motif Other DBs NCBI-ProteinID:  CBG36096 UniProt:  D3GVN6 LinkDB All DBs Position 3490219..3490467 Genome browser AA seq 82 aa AA seqDB search MVNREIVMDYILSCLQDLVENGVEIKPDSDLVNDLGLESIKVMDLLMMLEDRFDISIPIN ILLDVKTPAQLMETLLPWLENK NT seq 249 nt NT seq  +upstreamnt  +downstreamnt atggtaaatcgtgaaatagtaatggattacatcctttcctgtttacaggatttggtcgaa aacggtgtggaaattaagcccgacagcgatctcgtcaacgatcttggcctggagtcgatc aaagtgatggatctcttaatgatgctggaagacagattcgatatttccattcctattaat attctgctggatgtcaaaacccctgcgcaattaatggaaactctacttccatggctggag aataaataa

DBGET integrated database retrieval system