Escherichia coli P12b: P12B_c2013 Help Entry P12B_c2013        CDS       T02030                                  Symbol acpP Name (GenBank) Acyl carrier protein   KO K02078   acyl carrier protein Organism elp  Escherichia coli P12b Pathway elp01100   Metabolic pathways elp01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:elp00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     P12B_c2013 (acpP)    00074 Mycolic acid biosynthesis     P12B_c2013 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     P12B_c2013 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 DUF1896 TerB HLH Motif Other DBs NCBI-ProteinID:  AFG40862 LinkDB All DBs Position complement(2186567..2186803) Genome browser AA seq 78 aa AA seqDB search MSTIEERVKKIIGEQLGVKQEEVTNNASFVEDLGADSLDTVELVMALEEEFDTEIPDEEA EKITTVQAAIDYINGHQA NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcactatcgaagaacgcgttaagaaaattatcggcgaacagctgggcgttaagcag gaagaagttaccaacaatgcttctttcgttgaagacctgggcgcggattctcttgacacc gttgagctggtaatggctctggaagaagagtttgatactgagattccggacgaagaagct gagaaaatcaccaccgttcaggctgccattgattacatcaacggccaccaggcgtaa

DBGET integrated database retrieval system