KEGG   Erythrobacter litoralis DSM 8509: Ga0102493_111847
Entry
Ga0102493_111847  CDS       T04740                                 
Name
(GenBank) iron(III) transport system permease protein
  KO
K02011  iron(III) transport system permease protein
Organism
elq  Erythrobacter litoralis DSM 8509
Pathway
elq02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:elq00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    Ga0102493_111847
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:elq02000]
    Ga0102493_111847
Transporters [BR:elq02000]
 ABC transporters, prokaryotic type
  Mineral and organic ion transporters
   Iron(III) transporter
    Ga0102493_111847
SSDB
Motif
Pfam: BPD_transp_1
Other DBs
NCBI-ProteinID: AOL22869
LinkDB
Position
complement(971081..972781)
AA seq 566 aa
MAVQVSRIRRTGGPQASAAERPTVARRALARPRGWDWPALALAALAALPILAILLAAPSG
GMDAIVHMAGSVLPRYVVNTAALMALTGMLAGFIGVGCAWLVTAAEFPGRRVLGWALVLP
LAVPAYIAAYIYADLLDYAGPVQGALRGAFGEGTGALVPPIRSLPGGAFILAIVLYPYVY
LLARAAFAAQSLAQFRAARSLGAAPSRAFWRIALPAARPAIAGGLALVLMETLADFGVAE
YFAIPTFSTGIFRSWLAMGDKQAALKLAAIMLLFVIALVALEASTRSGRSESRDGRARGA
APLIELSPGRRILASLACALPVLLGFVLPALHLARLATSEAALGATRDLAAYASDSLWLG
LATAFACLAAALLLAFARSRSASPLVGGAIRLATLGYALPGALLAVGLLAPLGAFDVELT
RFARDTLGYAPGGLLLTGTSLFLIYALSVRFLTVAYNSVESGMATIPANLDAAARSLGAG
PARVLARIHAPLLAPSLGAAAALVFIDTLRELPATLILRPFNLETLATRTYRLASDERLA
EASIPALILLAAGILPVILLHRTARR
NT seq 1701 nt   +upstreamnt  +downstreamnt
atggctgtgcaagtgagccgcattaggcggacaggcggtccgcaggcaagcgcggcggaa
cgcccgacggtcgcgcggcgtgcgcttgcccgcccgcgcggctgggactggcccgcactt
gctcttgccgcgctcgccgctttgccgatcctcgcgatccttctggccgcgccatcgggc
gggatggatgcgatcgtgcacatggcaggctcggtgctgccgcgctacgtcgtcaacacg
gcggcgctgatggcgctgacggggatgctggcgggcttcatcggcgtgggctgcgcgtgg
cttgtcaccgcggcggaatttcccgggcggcgcgtgctcggctgggcgctggtcctgccg
ctcgccgttccggcctatatcgcggcctatatctatgccgaccttctcgattatgctggc
ccggtgcagggcgccctgcgcggcgcgttcggcgaagggacgggcgcgcttgtcccgccg
atccgttcgctgccgggcggggccttcatcctcgccatcgtgctctatccttacgtctac
ctcctcgcgcgcgccgccttcgccgcacagagcctcgcgcagttccgcgccgccaggagc
ctcggggcagcgccttcgcgggccttctggcggatcgccctgcccgccgcccgacccgcg
atcgcaggcggactcgcgctcgtgctgatggagacgctcgccgatttcggggtcgccgaa
tatttcgcgatcccgaccttttcgaccggcatcttcaggagctggctagcgatgggggac
aagcaggcagcgctcaagctggccgcgatcatgctccttttcgtcatcgcactcgtcgcg
ctcgaggcatcgacccgctccgggcggagcgaaagccgcgatggccgcgcgcggggcgca
gcgccgctgatcgagctgtcacccggccggcgcatcctggcgagccttgcctgcgccctg
ccggtcctgctcggcttcgttcttcccgcgcttcacctcgccaggctggcgacgagcgag
gcggcgctgggggcgacccgcgatcttgcagcctatgcctcggacagcctgtggctcggc
cttgcgacagcgtttgcctgtcttgccgccgcgcttctgcttgcgtttgcgcggagccgt
tcggcgagcccgctggtcggcggcgcgatccggcttgcgacattgggctacgcgctgcct
ggcgccttgctcgcggtcggcctgctcgccccgctcggggcgttcgatgtcgagcttacc
cggttcgcccgcgacacgctcggctatgcgcccggcggcctgctgctgacggggacgagc
cttttcctgatctacgcgctttcggtgcggttcctgacggtcgcctacaacagcgtcgaa
agcggcatggcgacgatcccggccaatctcgatgccgccgcgcgatccctgggcgcgggg
ccggcgcgggtgctggcgcgcatccacgccccgctgctcgcccccagcctcggcgcggcg
gcggcgctggtgttcatcgacaccctgcgcgaacttcccgcaacgctgatcctgcgtccg
ttcaatctcgaaacgctcgccacgcgcacctaccgcctcgccagcgacgagcggctcgcg
gaggcctcgatccccgcccttatcctgctggctgcgggcatcctgccagtgatcctgctg
catcgcaccgcgcgccgttga

DBGET integrated database retrieval system