Erythrobacter litoralis DSM 8509: Ga0102493_112232
Help
Entry
Ga0102493_112232 CDS
T04740
Name
(GenBank) ATP-dependent DNA helicase PcrA
KO
K03657
ATP-dependent DNA helicase UvrD/PcrA [EC:
5.6.2.4
]
Organism
elq
Erythrobacter litoralis DSM 8509
Pathway
elq03420
Nucleotide excision repair
elq03430
Mismatch repair
Brite
KEGG Orthology (KO) [BR:
elq00001
]
09120 Genetic Information Processing
09124 Replication and repair
03420 Nucleotide excision repair
Ga0102493_112232
03430 Mismatch repair
Ga0102493_112232
09180 Brite Hierarchies
09182 Protein families: genetic information processing
03400 DNA repair and recombination proteins [BR:
elq03400
]
Ga0102493_112232
Enzymes [BR:
elq01000
]
5. Isomerases
5.6 Isomerases altering macromolecular conformation
5.6.2 Enzymes altering nucleic acid conformation
5.6.2.4 DNA 3'-5' helicase
Ga0102493_112232
DNA repair and recombination proteins [BR:
elq03400
]
Prokaryotic type
SSBR (single strand breaks repair)
NER (nucleotide excision repair)
GGR (global genome repair) factors
Ga0102493_112232
MMR (mismatch excision repair)
Other MMR factors
Ga0102493_112232
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
UvrD-helicase
UvrD_C
AAA_19
UvrD_C_2
AAA_30
Viral_helicase1
PcrA_UvrD_tudor
AAA_12
DUF3553
AAA_11
DEAD
Motif
Other DBs
NCBI-ProteinID:
AOL23248
UniProt:
A0A074MCU8
LinkDB
All DBs
Position
complement(1342193..1344499)
Genome browser
AA seq
768 aa
AA seq
DB search
MTENSPLPAPSQSGVPPYAARLNPPQREAVLTTEGPVLMLAGAGTGKTAALTARLAHLVA
TRRAYPSQILCVTFTNKAAREMRERVGALLGQGAEGMPWLGTFHSICAKMLRRHAELVGL
QHNYTIIDTDDQIRLLKQLIADNDLDEKRWPARQLAGLIDRWKNRGLNPDDLDAAESEAY
ANGRGQALYRAYQDRLKALNACDFGDLMLHVLNIFRAHHDVLAEYQQRFRYILVDEYQDT
NAVQYLWLRLLAQERKNICVVGDDDQSIYSWRGAEVANILRFEKDFPGAHVVKLEQNYRS
TPHILGAASGLIRANSQRHDKTLWTEANGGDKVRVIGVWDAPEEARRVGEEIERLEGEGA
SLDEVAILVRAQYQTREFEDRFIQIGVNYRIIGGFRFYERAEIRDALAYLRVIAQPQDDL
AFERIYNQPKRGLGAKTLEKMHQHARRVGLPLAAASLQLADSDELPKRAANTIGGLLRQF
LAWREAAEQMTPADLLRLVLEESGYNAMLSADRSAESAGRAENLTELARAMEEYETLGDF
LEHVSLVMDNDRGDEEETVTIMTIHAAKGLEFDHVFCVGWEEGVFPSQRAIDEGGLASLE
EERRLAYVAITRARRRCMILHAANRRIYGQWTSSIPSRFIEELPEDHIEQETTLTGGASL
WRANWSENEDPFAHVARDRPDRAQARGPGWQRAIASGYETKQQRIRESGRSAASFAGQAR
SDIAIGAMVHHDKFGTGCVIDQEGNKLTINFEEAGEKRVIDSFVTVVG
NT seq
2307 nt
NT seq
+upstream
nt +downstream
nt
atgaccgaaaacagccccctccccgccccttcgcaatccggcgttccgccctatgcggcg
cgattgaatccgccgcagcgcgaggcggtgctgacgaccgaaggcccggtgctgatgctg
gcaggggccggcacgggcaagaccgccgctctgaccgcgcgcctcgcacatctggtcgcg
acgcgccgcgcctacccttcccagatcctttgcgtgaccttcaccaacaaggccgcccgc
gagatgagggagcgggtcggcgcgctgctgggacagggcgcggaaggtatgccctggctg
ggcaccttccattcgatctgcgccaagatgctgcgccgccatgccgagctggtcgggctg
cagcacaactacacgatcatcgacaccgacgatcagatccgcctgttgaaacagctcatc
gccgacaacgaccttgatgaaaaacgctggcctgcgcggcaactggccgggctgatcgac
cgctggaagaaccgcgggctcaaccccgacgatctcgatgcagccgaaagcgaagcctat
gccaacgggcgcggacaggcgctctaccgcgcctatcaggaccggctgaaggcgctgaac
gcctgcgatttcggcgatctgatgctgcacgtcctcaacatctttcgcgcccaccatgac
gtgctggccgaataccagcagcgtttccgctacatcctcgtcgacgaatatcaggatacc
aacgcggtccagtatctctggctccgcctgctcgcgcaggagcgcaagaacatctgtgtc
gtgggcgacgacgaccagtcgatctattcctggcgcggggcggaagtcgccaacatcctt
cgtttcgagaaggatttcccgggcgcgcacgtggtcaagctcgaacagaattaccgctcc
accccgcatatcctcggcgcggcatcgggcctgatccgggcgaacagtcagcgccacgac
aagacgctgtggaccgaggccaatggcggcgacaaggttcgcgtgatcggcgtgtgggac
gcgcccgaggaagcgcgccgcgtgggcgaggagatcgagcggctggagggcgaaggcgcg
agcctcgacgaggtcgcgatccttgtccgcgcgcaataccagacccgcgaattcgaggac
cgcttcatccagatcggggtcaattaccggatcatcgggggtttccgcttctacgaacgc
gccgaaatccgcgatgcgctcgcttacttgcgcgtcatagcccagccgcaggacgacctc
gccttcgaacgcatctacaaccagcccaagcgcggattgggcgcgaagacgctggaaaag
atgcaccagcacgcgcgccgcgtgggcctgccgctcgccgccgcctcgctgcaactggcc
gacagcgacgaattgcccaagcgcgcggcgaacacaatcggcggcctgctgcgccagttt
ctcgcgtggcgggaggcggcggaacagatgaccccggccgacctccttcgtctcgtgctc
gaggaatcgggctacaacgcgatgctttccgccgaccgctccgccgaaagcgcggggcgc
gcggaaaacctcaccgaactcgcccgcgcgatggaggaatacgagacgctcggcgatttc
ctcgaacacgtctccctcgtcatggacaacgatcgcggagacgaggaggagacggtcacg
atcatgacgatccacgccgccaaggggctcgaattcgaccatgtcttctgcgtcggctgg
gaggaaggcgtctttccttcccagcgcgcgatcgacgaaggggggctcgccagcctcgag
gaagagcgccgcctcgcctatgtcgcgatcacccgcgcgcgcaggcgctgcatgatcctc
cacgccgccaatcgccgcatctacggccagtggacgagttcgatcccctcgcgcttcatc
gaggaattgcccgaggaccatatcgagcaggaaacgacgctgaccggcggggcgagcctg
tggcgcgcgaactggagcgaaaacgaggaccccttcgcccatgtcgcgcgagaccggccc
gaccgcgcgcaggcccgcggccccggctggcagcgcgccatcgcatccggctacgagacg
aagcagcagcgcatccgcgaaagcgggcgttcggcggcgagcttcgccggacaggcgcgc
agcgacatcgcgatcggcgcgatggtccaccacgacaagttcggcaccggctgcgtgatc
gaccaggaaggcaacaagctgacgatcaatttcgaggaagcgggcgagaagcgcgtgatc
gacagcttcgtgacagtggtgggctag
DBGET
integrated database retrieval system