Erythrobacter litoralis DSM 8509: Ga0102493_112867 Help Entry Ga0102493_112867  CDS       T04740                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism elq  Erythrobacter litoralis DSM 8509 Pathway elq01100   Metabolic pathways elq01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:elq00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     Ga0102493_112867 (acpP)    00074 Mycolic acid biosynthesis     Ga0102493_112867 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     Ga0102493_112867 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding ACP_SdgA_C PP-binding_2 Ribosomal_L12_N DUF1493 TerB_C DUF5783 Ribosomal_L50 Motif Other DBs NCBI-ProteinID:  AOL23871 UniProt:  A0A074N148 LinkDB All DBs Position complement(1999498..1999734) Genome browser AA seq 78 aa AA seqDB search MSDTADRVQKIVVEHLGVEADKVTQDASFIDDLGADSLDIVELVMAFEEEFGVEIPDDAA EKISTVGDATKYIEEHKG NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcgatactgccgaccgcgtgcagaagattgtcgtcgagcatctcggtgtcgaggcc gacaaggtcacccaggatgcgagcttcatcgacgatctgggcgccgacagcctcgacatc gtcgaactagtcatggctttcgaagaagaattcggcgtcgaaatccctgatgacgcggcg gagaagatttcgaccgtgggcgatgcgaccaagtatatcgaggaacacaagggataa

DBGET integrated database retrieval system