Escherichia coli O55 H7 RM12579 (EPEC): ECO55CA74_06440 Help Entry ECO55CA74_06440   CDS       T02066                                  Name (GenBank) DNA damage-inducible protein I   KO K12149   DNA-damage-inducible protein I Organism elr  Escherichia coli O55:H7 RM12579 (EPEC) Brite KEGG Orthology (KO) [BR:elr00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03400 DNA repair and recombination proteins [BR:elr03400]     ECO55CA74_06440 DNA repair and recombination proteins [BR:elr03400]  Prokaryotic type   TLS (translesion DNA synthesis) factors    Other SOS response factors     ECO55CA74_06440 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  DinI Motif Other DBs NCBI-ProteinID:  AEZ39891 LinkDB All DBs Position complement(1372395..1372640) Genome browser AA seq 81 aa AA seqDB search MRIEVTIAKTSPLPAGAIDALAGELSRRIQYAFPDNEGHVSVRYAAANNLSVIGATKEDK QRISEILQETWESADDWFVSE NT seq 246 nt NT seq  +upstreamnt  +downstreamnt atgcgaattgaagtcaccatagcgaaaacttctccattgccagctggggctattgacgcc ctggctggcgaactttcccgccgtattcagtatgcgtttcctgataatgaaggccacgta tcagtacgttatgccgcagcgaataatttatcggttattggcgcgacaaaagaagataaa cagcgcattagcgaaattctccaagaaacgtgggaaagcgccgatgactggtttgtcagc gaataa

DBGET integrated database retrieval system