Escherichia coli O55 H7 RM12579 (EPEC): ECO55CA74_17635 Help Entry ECO55CA74_17635   CDS       T02066                                  Name (GenBank) hypothetical protein   KO K02078   acyl carrier protein Organism elr  Escherichia coli O55:H7 RM12579 (EPEC) Pathway elr01100   Metabolic pathways elr01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:elr00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     ECO55CA74_17635    00074 Mycolic acid biosynthesis     ECO55CA74_17635   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     ECO55CA74_17635 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding DUF1493 BH4 Motif Other DBs NCBI-ProteinID:  AEZ42088 LinkDB All DBs Position 3664617..3664865 Genome browser AA seq 82 aa AA seqDB search MVNREIVMDYILSCLQDLVENGVEIKPDSDLVNDLGLESIKVMDLLMMLEDRFDISIPIN ILLDVKTPAQLMETLLPWLENK NT seq 249 nt NT seq  +upstreamnt  +downstreamnt atggtaaatcgtgaaatagtaatggattacatcctttcctgtttacaggatttggtcgaa aacggtgtggaaattaagcccgacagcgatctcgtcaacgatcttggcctggagtcgatc aaagtgatggatctcttaatgatgctggaagacagattcgatatttccattcctattaat attctgctggatgtcaaaacccctgcgcaattaatggaaactctacttccatggctggag aataaataa

DBGET integrated database retrieval system