Esox lucius (northern pike): 105012960 Help Entry 105012960         CDS       T04894                                  Name (RefSeq) elongin-B isoform X1   KO K03873   elongin-B Organism els  Esox lucius (northern pike) Pathway els04120   Ubiquitin mediated proteolysis Brite KEGG Orthology (KO) [BR:els00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     105012960  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:els04121]     105012960    03400 DNA repair and recombination proteins [BR:els03400]     105012960 Ubiquitin system [BR:els04121]  Ubiquitin ligases (E3)   Multi subunit type E3    Cul2 complex     Adoptor protein      105012960    Cul5 complex      105012960 DNA repair and recombination proteins [BR:els03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     Other NER factors      105012960 SSDB OrthologParalogGFIT Motif Pfam:  ubiquitin Rad60-SLD Motif Other DBs NCBI-GeneID:  105012960 NCBI-ProteinID:  XP_010872451 UniProt:  A0AAY5KG80 LinkDB All DBs Position LG11:27171389..27176232 Genome browser AA seq 119 aa AA seqDB search MDVFLMIRRHKTTIFTDAKESTTVYELKRIVEGILKRAPEEQRLYKDDMLLEDSKTLGDC GFTNQTARPQAPATVGLAFRLGDDAFEQLRVEPFSSPPELPDVMKPQDSGSTANEQAVQ NT seq 360 nt NT seq  +upstreamnt  +downstreamnt atggatgtgtttctgatgatccggcgtcataagacgaccatcttcactgatgccaaagag tccactactgtctatgagctgaagcgcatagtggagggtattctaaagagagcaccagag gaacagaggctgtataaggatgatatgttgctggaggatagtaagacacttggagactgt ggctttacaaaccagacagccagacctcaggccccggccactgttggattagctttccgt cttggtgatgatgcatttgagcagctgagagttgagcccttctccagccccccagagctc cctgacgtcatgaagcctcaggactcaggcagcacagccaatgagcaggctgtacagtga

DBGET integrated database retrieval system