Esox lucius (northern pike): 105018344 Help Entry 105018344         CDS       T04894                                  Symbol hras Name (RefSeq) GTPase HRas   KO K02833   GTPase HRas Organism els  Esox lucius (northern pike) Pathway els04010   MAPK signaling pathway els04012   ErbB signaling pathway els04068   FoxO signaling pathway els04137   Mitophagy - animal els04140   Autophagy - animal els04144   Endocytosis els04150   mTOR signaling pathway els04210   Apoptosis els04218   Cellular senescence els04370   VEGF signaling pathway els04371   Apelin signaling pathway els04510   Focal adhesion els04540   Gap junction els04625   C-type lectin receptor signaling pathway els04810   Regulation of actin cytoskeleton els04910   Insulin signaling pathway els04912   GnRH signaling pathway els04916   Melanogenesis els05132   Salmonella infection Brite KEGG Orthology (KO) [BR:els00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     105018344 (hras)    04012 ErbB signaling pathway     105018344 (hras)    04370 VEGF signaling pathway     105018344 (hras)    04371 Apelin signaling pathway     105018344 (hras)    04068 FoxO signaling pathway     105018344 (hras)    04150 mTOR signaling pathway     105018344 (hras)  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     105018344 (hras)    04140 Autophagy - animal     105018344 (hras)    04137 Mitophagy - animal     105018344 (hras)   09143 Cell growth and death    04210 Apoptosis     105018344 (hras)    04218 Cellular senescence     105018344 (hras)   09144 Cellular community - eukaryotes    04510 Focal adhesion     105018344 (hras)    04540 Gap junction     105018344 (hras)   09142 Cell motility    04810 Regulation of actin cytoskeleton     105018344 (hras)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     105018344 (hras)   09152 Endocrine system    04910 Insulin signaling pathway     105018344 (hras)    04912 GnRH signaling pathway     105018344 (hras)    04916 Melanogenesis     105018344 (hras)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     105018344 (hras)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:els04131]     105018344 (hras)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:els04147]     105018344 (hras)    04031 GTP-binding proteins [BR:els04031]     105018344 (hras) Membrane trafficking [BR:els04131]  Exocytosis   Small GTPases and associated proteins    Other small GTPases and associated proteins     105018344 (hras)  Endocytosis   Macropinocytosis    Ras GTPases     105018344 (hras) Exosome [BR:els04147]  Exosomal proteins   Exosomal proteins of other body fluids (saliva and urine)    105018344 (hras)   Exosomal proteins of colorectal cancer cells    105018344 (hras) GTP-binding proteins [BR:els04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     105018344 (hras) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 RsgA_GTPase FeoB_N ATP_bind_1 Septin DUF6974 Ldh_1_N Motif Other DBs NCBI-GeneID:  105018344 NCBI-ProteinID:  XP_010881986 LinkDB All DBs Position LG19:complement(15604723..15631725) Genome browser AA seq 189 aa AA seqDB search MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG QEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDL PARTVDTRQAQELARSYGIPYIETSAKTRQGVEDAFYTLVREIRQHKLRKLNPPDESGQD CMSCRCVVS NT seq 570 nt NT seq  +upstreamnt  +downstreamnt atgacggagtacaagctggtagtggtgggggctggaggtgtggggaagagtgcactcacc atccagctcatccagaaccactttgtggacgaatacgaccccactatagaggactcgtac aggaagcaggtggtgattgacggggagacgtgtcttctggacatcctggacactgcaggt caggaggagtacagcgccatgagggaccagtacatgaggacaggagagggcttcctctgt gtcttcgccatcaacaacaccaagtccttcgaggacatccaccagtacagagaacagatc aagcgtgtgaaggactctgatgatgtgcccatggtgctcgtgggtaataaatgtgatctt cccgcgcgtactgtggacacacggcaagcacaggaactggcccgcagctacggaattccc tatatcgagacctcagccaagacacgacagggggtagaggatgccttctacactctggtc agggagatcaggcagcacaagctgaggaagctcaatcctcctgacgagagcggacaggac tgtatgagctgccgctgtgtggtgtcgtga

DBGET integrated database retrieval system