Esox lucius (northern pike): 105019030 Help Entry 105019030         CDS       T04894                                  Symbol atg12 Name (RefSeq) ubiquitin-like protein ATG12   KO K08336   ubiquitin-like protein ATG12 Organism els  Esox lucius (northern pike) Pathway els04068   FoxO signaling pathway els04136   Autophagy - other els04140   Autophagy - animal els04621   NOD-like receptor signaling pathway els04622   RIG-I-like receptor signaling pathway Brite KEGG Orthology (KO) [BR:els00001]  09130 Environmental Information Processing   09132 Signal transduction    04068 FoxO signaling pathway     105019030 (atg12)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     105019030 (atg12)    04136 Autophagy - other     105019030 (atg12)  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     105019030 (atg12)    04622 RIG-I-like receptor signaling pathway     105019030 (atg12)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:els04131]     105019030 (atg12)    04121 Ubiquitin system [BR:els04121]     105019030 (atg12)    03029 Mitochondrial biogenesis [BR:els03029]     105019030 (atg12) Membrane trafficking [BR:els04131]  Autophagy   Autophagosome formation proteins    Atg12 conjugation proteins     105019030 (atg12) Ubiquitin system [BR:els04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitin-like proteins (UBLs)    105019030 (atg12) Mitochondrial biogenesis [BR:els03029]  Mitochondrial quality control factors   Mitophagy factors    Autophagy-related proteins     105019030 (atg12) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  APG12 ATG8 XendoU Motif Other DBs NCBI-GeneID:  105019030 NCBI-ProteinID:  XP_010883214 UniProt:  A0A3P8YHX5 LinkDB All DBs Position LG20:complement(19079061..19082382) Genome browser AA seq 120 aa AA seqDB search MSDNAESPTETQKCDPSTTQQPTEDSGTTDEKKKIDVLLKAVGDTPIMKTKKWSVEKGRT VQSLSQFISRFLKMEPNEQLFIYVNQSFSPSPDQEVGVLFECFGSDGKLVLHYCKSQAWG NT seq 363 nt NT seq  +upstreamnt  +downstreamnt atgtctgacaatgcagagtctcccacagaaacgcaaaaatgtgacccttcaaccacacaa cagcctactgaagactcgggaacgacagacgaaaagaaaaaaattgatgtgttgctaaag gccgtcggtgatactcctatcatgaagactaagaaatggtcggtggagaaagggaggacg gtgcaatcactctcacagttcatatctcgctttctcaagatggagcccaacgaacagctg ttcatttatgtcaaccagtcattttcaccctctcctgatcaagaagtaggagtcttgttt gagtgttttggcagtgatgggaaactggttctacattactgtaaatctcaagcctggggt taa

DBGET integrated database retrieval system