Esox lucius (northern pike): 105020103 Help Entry 105020103         CDS       T04894                                  Name (RefSeq) claudin-like protein ZF-A9   KO K06087   claudin Organism els  Esox lucius (northern pike) Pathway els03272   Virion - Hepatitis viruses els04382   Cornified envelope formation els04514   Cell adhesion molecules els04530   Tight junction Brite KEGG Orthology (KO) [BR:els00001]  09120 Genetic Information Processing   09125 Information processing in viruses    03272 Virion - Hepatitis viruses     105020103  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04514 Cell adhesion molecules     105020103  09140 Cellular Processes   09144 Cellular community - eukaryotes    04530 Tight junction     105020103  09150 Organismal Systems   09158 Development and regeneration    04382 Cornified envelope formation     105020103  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:els03037]     105020103    04147 Exosome [BR:els04147]     105020103    04515 Cell adhesion molecules [BR:els04515]     105020103 Cilium and associated proteins [BR:els03037]  Other cilia and associated proteins   Stereociliary proteins    105020103 Exosome [BR:els04147]  Exosomal proteins   Exosomal proteins of ovarian cancer cells    105020103   Exosomal proteins of colorectal cancer cells    105020103 Cell adhesion molecules [BR:els04515]  Immunoglobulin superfamily   L1 family    105020103 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PMP22_Claudin Claudin_2 DUF4383 Zip Motif Other DBs NCBI-GeneID:  105020103 NCBI-ProteinID:  XP_019897889 LinkDB All DBs Position LG22:complement(1276353..1278421) Genome browser AA seq 169 aa AA seqDB search MSVRLEVLGLTQVYDSMLALSMDLQVARAILIISILVCVVGTLASIAGATFTNCLAESFR TKARVALAAGVLFLVAGVLGLVPPSWTAHQVITDFYNPLVHQGMKKVWGCHLHLLGVWCS HGYRRRLEVERIRGSTRWRPPVTSTAMSRPHLMPNLPNLNLCSHPMTLD NT seq 510 nt NT seq  +upstreamnt  +downstreamnt atgtctgtgagactagaggtgctgggcttaactcaggtgtatgactccatgctggcgctc tccatggacctccaggttgcccgagccatcttgataatctccatcttggtttgtgtggtg ggcacccttgccagcattgcaggggcgacgttcaccaactgcctggctgagagtttcaga actaaggcccgggttgccttggcagcaggggttctgtttctggttgctggtgttctgggt ctggtccctcccagctggacagctcaccaggtaatcactgatttctataaccccctggtc caccagggcatgaagaaggtttggggctgccatcttcatctgctgggggtctggtgctct catggctataggagaaggttggaggtcgaaaggataaggggcagtacaagatggcggcca ccagtcacttccacagccatgagcaggccacatcttatgcctaacctgccaaacctcaac ctgtgttcacatccaatgactctggactga

DBGET integrated database retrieval system