Esox lucius (northern pike): 105021727 Help Entry 105021727         CDS       T04894                                  Name (RefSeq) insulin   KO K04526   insulin Organism els  Esox lucius (northern pike) Pathway els04010   MAPK signaling pathway els04068   FoxO signaling pathway els04081   Hormone signaling els04114   Oocyte meiosis els04140   Autophagy - animal els04150   mTOR signaling pathway els04810   Regulation of actin cytoskeleton els04910   Insulin signaling pathway els04914   Progesterone-mediated oocyte maturation Brite KEGG Orthology (KO) [BR:els00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     105021727    04068 FoxO signaling pathway     105021727    04150 mTOR signaling pathway     105021727   09133 Signaling molecules and interaction    04081 Hormone signaling     105021727  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     105021727   09143 Cell growth and death    04114 Oocyte meiosis     105021727   09142 Cell motility    04810 Regulation of actin cytoskeleton     105021727  09150 Organismal Systems   09152 Endocrine system    04910 Insulin signaling pathway     105021727    04914 Progesterone-mediated oocyte maturation     105021727  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:els04052]     105021727 Cytokines and neuropeptides [BR:els04052]  Neuropeptides   Unclassified    105021727 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Insulin Ins_beta Motif Other DBs NCBI-GeneID:  105021727 NCBI-ProteinID:  XP_010887889 UniProt:  A0AAY5KWU4 LinkDB All DBs Position LG14:6450279..6451184 Genome browser AA seq 151 aa AA seqDB search MGGRTRLFGLKQLSSSAGLLLLSRASLPPPPLPPQPSVTMALWLQAAASLLVLLALTSSP GVDAAAAPQRLCGSHLVEALFLVCGEKGFFSYSPKRDADHLAWFLSPKSAQESKVVEYPF DSQMEVMVKRGIVDECCNKPCSIFDLNNYCN NT seq 456 nt NT seq  +upstreamnt  +downstreamnt atggggggaaggacccggttgtttggcctcaagcaactctcctcttcagccggtctgctg ctactctccagagcttctcttccgccacctccacttccaccacagccctccgtcaccatg gccctctggctccaggctgctgcatctcttctggtgctgctggctctcacctcctccccc ggcgtggacgctgccgccgccccccagcgcctgtgcggctctcacctggtggaagccctc ttcctggtatgcggagagaaaggcttcttctcctacagcccaaagagagacgcggatcac cttgcatggttcttatcgcccaagtcggcccaggagagcaaggttgtggagtatcccttc gatagccagatggaggtgatggtcaagaggggcatcgtggacgagtgctgtaacaagccc tgcagcatctttgacctgaataactattgcaactga

DBGET integrated database retrieval system