Esox lucius (northern pike): 105024458 Help Entry 105024458         CDS       T04894                                  Name (RefSeq) protein S100-A1-like   KO K17274   protein S100-A10 Organism els  Esox lucius (northern pike) Pathway els04382   Cornified envelope formation els05132   Salmonella infection Brite KEGG Orthology (KO) [BR:els00001]  09150 Organismal Systems   09158 Development and regeneration    04382 Cornified envelope formation     105024458  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     105024458  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:els04147]     105024458 Exosome [BR:els04147]  Exosomal proteins   Exosomal proteins of microglial cells    105024458 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  S_100 EF-hand_7 EF-hand_1 EF-hand_6 EF-hand_8 EF-hand_5 HEPN_AbiU2 EH Motif Other DBs NCBI-GeneID:  105024458 NCBI-ProteinID:  NP_001297937 UniProt:  C1BXN9 LinkDB All DBs Position LG20:17310921..17315798 Genome browser AA seq 100 aa AA seqDB search MPSQLESAMESLIMVFHRYSDKDGKRNTLSKKELKQLMETELASFLKSQKDPATIDKIMK DLDQNGDGEVSFEEFVSLVVGLSIACEEIYQLQSKTPSKK NT seq 303 nt NT seq  +upstreamnt  +downstreamnt atgccgtctcagttggaaagtgccatggagtccctgatcatggtgttccatcgctattcc gacaaagatggtaaacgcaacacactgagcaagaaggagctcaaacagctcatggagaca gaactggccagcttcctgaagtcccagaaggacccagctaccatagacaagataatgaag gacctggatcagaatggtgatggggaggtgagctttgaagagtttgtgtctctggtggtg ggcctctccattgcttgtgaagaaatctaccagctccagagcaagactccctccaagaag taa

DBGET integrated database retrieval system