Esox lucius (northern pike): 105025252 Help Entry 105025252         CDS       T04894                                  Name (RefSeq) transforming protein RhoA   KO K04513   Ras homolog gene family, member A Organism els  Esox lucius (northern pike) Pathway els04081   Hormone signaling els04144   Endocytosis els04150   mTOR signaling pathway els04270   Vascular smooth muscle contraction els04310   Wnt signaling pathway els04350   TGF-beta signaling pathway els04510   Focal adhesion els04520   Adherens junction els04530   Tight junction els04621   NOD-like receptor signaling pathway els04625   C-type lectin receptor signaling pathway els04810   Regulation of actin cytoskeleton els05100   Bacterial invasion of epithelial cells els05132   Salmonella infection Brite KEGG Orthology (KO) [BR:els00001]  09130 Environmental Information Processing   09132 Signal transduction    04310 Wnt signaling pathway     105025252    04350 TGF-beta signaling pathway     105025252    04150 mTOR signaling pathway     105025252   09133 Signaling molecules and interaction    04081 Hormone signaling     105025252  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     105025252   09144 Cellular community - eukaryotes    04510 Focal adhesion     105025252    04520 Adherens junction     105025252    04530 Tight junction     105025252   09142 Cell motility    04810 Regulation of actin cytoskeleton     105025252  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     105025252    04625 C-type lectin receptor signaling pathway     105025252   09153 Circulatory system    04270 Vascular smooth muscle contraction     105025252  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     105025252    05100 Bacterial invasion of epithelial cells     105025252  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:els04131]     105025252   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:els04147]     105025252    04031 GTP-binding proteins [BR:els04031]     105025252 Membrane trafficking [BR:els04131]  Endocytosis   Lipid raft mediated endocytosis    RhoA-dependent endocytosis     105025252 Exosome [BR:els04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    105025252   Exosomal proteins of other body fluids (saliva and urine)    105025252   Exosomal proteins of colorectal cancer cells    105025252   Exosomal proteins of bladder cancer cells    105025252 GTP-binding proteins [BR:els04031]  Small (monomeric) G-proteins   Rho Family    RhoA/B/C [OT]     105025252 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Gtr1_RagA SRPRB VASP_tetra Motif Other DBs NCBI-GeneID:  105025252 NCBI-ProteinID:  XP_010894111 UniProt:  A0A3P8Y411 LinkDB All DBs Position LG12:complement(32983010..32990823) Genome browser AA seq 193 aa AA seqDB search MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDSKQVELALWDT AGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKD LRNDEHTRRELAKMKQEPVKPEEGRDMANRIGAFGYMECSAKTKDGVREVFEMATRAALQ ARRGKKNSKCLLL NT seq 582 nt NT seq  +upstreamnt  +downstreamnt atggcagcaattcgtaagaagctggtgattgtgggagatggtgcttgtgggaagacatgt ctgttgatagtcttcagtaaagaccagttccctgaggtctatgtacccactgtatttgag aactatgtggctgacattgaagtggacagcaagcaggtggagttggctctgtgggatacc gctggccaagaagactacgacaggcttcgccccctctcctaccccgacactgacgtcatt ctcatgtgcttttccattgacagcccagacagtttggagaacattccagaaaaatggact ccggaggtcaaacacttctgtcccaatgttcccatcatccttgtgggcaacaagaaggat ctgcgcaacgatgaacacacacgccgtgagctggccaaaatgaaacaggagccagtgaag ccagaggagggccgagacatggccaacaggattggcgcgttcggctacatggagtgctca gccaagacgaaggacggagtgcgggaggtgtttgagatggctaccagagcggcactacaa gcccgaaggggaaagaagaacagtaaatgtctcctgctgtag

DBGET integrated database retrieval system