Esox lucius (northern pike): 105027143 Help Entry 105027143         CDS       T04894                                  Name (RefSeq) protein S100-A1   KO K17274   protein S100-A10 Organism els  Esox lucius (northern pike) Pathway els04382   Cornified envelope formation els05132   Salmonella infection Brite KEGG Orthology (KO) [BR:els00001]  09150 Organismal Systems   09158 Development and regeneration    04382 Cornified envelope formation     105027143  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     105027143  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:els04147]     105027143 Exosome [BR:els04147]  Exosomal proteins   Exosomal proteins of microglial cells    105027143 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  S_100 EF-hand_1 EF-hand_7 EF-hand_5 EF-hand_6 EF-hand_8 DAXX_hist_bd EH MCM4_WHD Motif Other DBs NCBI-GeneID:  105027143 NCBI-ProteinID:  NP_001297838 UniProt:  C1BWB4 LinkDB All DBs Position LG10:complement(26769931..26772808) Genome browser AA seq 99 aa AA seqDB search MPSDLERAMESLIVVFHKYAAKEGCGNTLSRRELKDLMENELSGFLKSQKDPATVDKIMK DLDSNGDGEVDFEEFVSLVVGLSIACEQCYQLHEKKMGK NT seq 300 nt NT seq  +upstreamnt  +downstreamnt atgccttcagatctggaacgtgccatggagtccctgatcgtcgtgtttcacaagtacgcc gcaaaggagggctgtggcaacactctgagccgccgcgagctcaaggacctgatggagaac gagctgtccggcttcctcaagtctcagaaggacccagccacagtagacaaaatcatgaag gatctggactctaacggtgatggagaggtggactttgaggagtttgtttctctagttgtg ggtctgtccattgcctgtgagcagtgctaccagttgcacgagaagaagatgggaaagtga

DBGET integrated database retrieval system