Esox lucius (northern pike): 105027466 Help Entry 105027466         CDS       T04894                                  Symbol ubl5 Name (RefSeq) ubiquitin-like protein 5   KO K13113   ubiquitin-like protein 5 Organism els  Esox lucius (northern pike) Brite KEGG Orthology (KO) [BR:els00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03041 Spliceosome [BR:els03041]     105027466 (ubl5)   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:els04052]     105027466 (ubl5) Spliceosome [BR:els03041]  Complex B   Other components    Complex B specific factors     105027466 (ubl5) Cytokines and neuropeptides [BR:els04052]  Neuropeptides   Unclassified    105027466 (ubl5) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ubiquitin Ubiquitin_2 Crinkler Motif Other DBs NCBI-GeneID:  105027466 NCBI-ProteinID:  XP_028978339 LinkDB All DBs Position LG09:complement(736459..739344) Genome browser AA seq 73 aa AA seqDB search MIEVVCNDRLGKKVRVKCNSEDTIGDLKKLIAAQTGTRWDKIVLKKWYTIFKDHVSLGDY EIHDGQNLELYYQ NT seq 222 nt NT seq  +upstreamnt  +downstreamnt atgattgaagtggtatgcaatgaccgtctgggcaagaaggtccgcgtaaaatgcaactct gaagacacaataggtgacctgaagaagctcatcgctgcccagacaggcacccggtgggac aagatcgttctgaagaagtggtacaccatatttaaggaccacgtgtctctgggagactat gagatccatgatggacagaacctggagctatactatcagtag

DBGET integrated database retrieval system