Esox lucius (northern pike): 105029053 Help Entry 105029053         CDS       T04894                                  Name (RefSeq) GTPase HRas-like   KO K07827   GTPase KRas Organism els  Esox lucius (northern pike) Pathway els04010   MAPK signaling pathway els04012   ErbB signaling pathway els04068   FoxO signaling pathway els04137   Mitophagy - animal els04140   Autophagy - animal els04150   mTOR signaling pathway els04210   Apoptosis els04218   Cellular senescence els04370   VEGF signaling pathway els04371   Apelin signaling pathway els04540   Gap junction els04625   C-type lectin receptor signaling pathway els04810   Regulation of actin cytoskeleton els04910   Insulin signaling pathway els04912   GnRH signaling pathway els04914   Progesterone-mediated oocyte maturation els04916   Melanogenesis Brite KEGG Orthology (KO) [BR:els00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     105029053    04012 ErbB signaling pathway     105029053    04370 VEGF signaling pathway     105029053    04371 Apelin signaling pathway     105029053    04068 FoxO signaling pathway     105029053    04150 mTOR signaling pathway     105029053  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     105029053    04137 Mitophagy - animal     105029053   09143 Cell growth and death    04210 Apoptosis     105029053    04218 Cellular senescence     105029053   09144 Cellular community - eukaryotes    04540 Gap junction     105029053   09142 Cell motility    04810 Regulation of actin cytoskeleton     105029053  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     105029053   09152 Endocrine system    04910 Insulin signaling pathway     105029053    04912 GnRH signaling pathway     105029053    04914 Progesterone-mediated oocyte maturation     105029053    04916 Melanogenesis     105029053  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:els04131]     105029053   09183 Protein families: signaling and cellular processes    04031 GTP-binding proteins [BR:els04031]     105029053 Membrane trafficking [BR:els04131]  Endocytosis   Macropinocytosis    Ras GTPases     105029053 GTP-binding proteins [BR:els04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     105029053 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU RsgA_GTPase MMR_HSR1 FeoB_N Septin SatRNA_48 Motif Other DBs NCBI-GeneID:  105029053 NCBI-ProteinID:  XP_010900487 UniProt:  A0A3P8Y8Y0 LinkDB All DBs Position LG11:complement(35570772..35577108) Genome browser AA seq 187 aa AA seqDB search MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG QEEYSAMRDQYMRTGEGFLCVFAINNVKSFEDVHLYREQINRVKDSDSVPMVLVGNKSDL GTRSVESRQAQELARGYGVPFVETSAKTRQGVEEAFYSLVREIRRYKETNRSSKKSKKNT PRRCAIL NT seq 564 nt NT seq  +upstreamnt  +downstreamnt atgactgagtataagcttgttgttgtcggagcaggaggtgtggggaagagtgcgctgaca atccagctcatccagaatcactttgtggatgaatatgaccccaccattgaggactcgtac aggaagcaggtggtgattgacggggagacgtgtctgctggacatcctggacactgccggt caggaggagtacagcgccatgagggaccagtacatgaggacaggagagggcttcctctgt gtcttcgccatcaacaacgtcaagtccttcgaggacgtccacctgtacagggagcagatc aacagggtgaaggacagcgacagtgtgcccatggtgctggtgggcaataagagtgacctg ggcacccggagtgtggagagcagacaggcccaggagctggcccgcggttacggcgtgccc ttcgtcgagacatcggccaaaacccgacagggagtggaggaggcattctactctttagtc agggaaatcaggaggtataaggaaaccaaccgcagcagcaagaagagcaagaaaaacacg ccgaggcgttgcgccatactatag

DBGET integrated database retrieval system