Esox lucius (northern pike): 105029096 Help Entry 105029096         CDS       T04894                                  Symbol rras Name (RefSeq) ras-related protein R-Ras   KO K07830   Ras-related protein R-Ras2 Organism els  Esox lucius (northern pike) Pathway els04010   MAPK signaling pathway els04137   Mitophagy - animal els04140   Autophagy - animal els04218   Cellular senescence els04371   Apelin signaling pathway els04625   C-type lectin receptor signaling pathway els04810   Regulation of actin cytoskeleton Brite KEGG Orthology (KO) [BR:els00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     105029096 (rras)    04371 Apelin signaling pathway     105029096 (rras)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     105029096 (rras)    04137 Mitophagy - animal     105029096 (rras)   09143 Cell growth and death    04218 Cellular senescence     105029096 (rras)   09142 Cell motility    04810 Regulation of actin cytoskeleton     105029096 (rras)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     105029096 (rras)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:els04147]     105029096 (rras)    04031 GTP-binding proteins [BR:els04031]     105029096 (rras) Exosome [BR:els04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    105029096 (rras)   Exosomal proteins of bladder cancer cells    105029096 (rras) GTP-binding proteins [BR:els04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     105029096 (rras) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 ATP_bind_1 Motif Other DBs NCBI-GeneID:  105029096 NCBI-ProteinID:  XP_010900561 UniProt:  A0AAY5KLU5 LinkDB All DBs Position LG11:51324910..51331419 Genome browser AA seq 197 aa AA seqDB search MSAEEERFKLVVVGGGGVGKSALTIQFIQSYFVSDYDPTIEDSYTKICTVDGKETRLDIL DTAGQEEFGAMREQYMRSGEGFLLVFALNDMGSYNEIHKFHTQILRVKDRDDFPMVLVGN KADLEQSRVISREEAQGFARENRIHYMEASAKNRYNVDEAFLEVVRAIRKFQETESPPLP VNHPGKRKSGGCPCTIL NT seq 594 nt NT seq  +upstreamnt  +downstreamnt atgtctgctgaagaggaaagatttaaactggtggtcgtaggtgggggcggtgtgggcaaa agtgccttgaccatacaattcattcagtcatactttgtatcagattatgaccccactatt gaggactcctacaccaaaatctgcacagtggatggaaaagagacgcgattagacatcttg gacacagcaggtcaagaggagtttggagcaatgagggagcagtacatgcgctcaggggaa ggattcctactggtgtttgctctgaatgacatgggcagttacaatgagatccacaagttt cacacccagatactgagagtgaaggaccgggacgacttccccatggtgctggtggggaac aaggctgacctggagcagtcaagagtgatttccagagaagaggcccagggctttgctaga gagaacaggatccattacatggaagcctctgctaagaaccgctacaatgtagatgaagcc ttcttggaggtggtgagagccataagaaagtttcaggagactgagagtcctcctctccca gtgaaccaccctgggaaacggaagagtggaggctgcccctgcaccattctctaa

DBGET integrated database retrieval system