Esox lucius (northern pike): 105029455 Help Entry 105029455         CDS       T04894                                  Name (RefSeq) protein dpy-30 homolog   KO K14965   protein dpy-30 Organism els  Esox lucius (northern pike) Brite KEGG Orthology (KO) [BR:els00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:els03036]     105029455 Chromosome and associated proteins [BR:els03036]  Eukaryotic type   Histone modification proteins    HMT complexes     COMPASS/SET1 complex      105029455     MLL-HCF complex      105029455     MLL3/MLL4 complex      105029455 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Dpy-30 Phlebovirus_NSM RIIa CTF_NFI Motif Other DBs NCBI-GeneID:  105029455 NCBI-ProteinID:  XP_010901125 UniProt:  A0AAY5K9K3 LinkDB All DBs Position LG05:1610307..1612218 Genome browser AA seq 88 aa AA seqDB search MAEDHADMDQSMESQTAKIEDTERVNADKISKQKVDLQSLPTRAYLDQTVVPVLLQGLSV LAKERPHNPIEFLAAHLLQNKSQYEDRI NT seq 267 nt NT seq  +upstreamnt  +downstreamnt atggctgaagatcacgcagacatggatcagagcatggaaagtcaaacagcgaaaatcgag gatacagagcgtgttaacgcagacaagatctctaaacagaaggttgatcttcagtctctc ccaacaagggcttatctggaccagacggtggttccagtccttctacagggactctctgtg ctagctaaagaaaggccgcacaatccaattgaatttttagccgcccacctgcttcagaac aagtctcaatatgaggaccgcatttga

DBGET integrated database retrieval system