Esox lucius (northern pike): 105030139 Help Entry 105030139         CDS       T04894                                  Name (RefSeq) elongin-B   KO K03873   elongin-B Organism els  Esox lucius (northern pike) Pathway els04120   Ubiquitin mediated proteolysis Brite KEGG Orthology (KO) [BR:els00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     105030139  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:els04121]     105030139    03400 DNA repair and recombination proteins [BR:els03400]     105030139 Ubiquitin system [BR:els04121]  Ubiquitin ligases (E3)   Multi subunit type E3    Cul2 complex     Adoptor protein      105030139    Cul5 complex      105030139 DNA repair and recombination proteins [BR:els03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     Other NER factors      105030139 SSDB OrthologParalogGFIT Motif Pfam:  ubiquitin Rad60-SLD Motif Other DBs NCBI-GeneID:  105030139 NCBI-ProteinID:  XP_010902131 LinkDB All DBs Position LG05:33009508..33019444 Genome browser AA seq 119 aa AA seqDB search MDVFLMIRRQKTTIFTDAKESTTVYELKRIVEGILKRAPEEQRLFKDDQLLEDCKTLGDC GFTNQTARPQAPGTVGLAFRIGDEMFEQLQLEAFSSPPELPDVMKPQDSGSTANEQAVQ NT seq 360 nt NT seq  +upstreamnt  +downstreamnt atggatgtctttcttatgatacggcgtcagaagaccaccatcttcacagatgccaaagag tccaccaccgtctatgagctgaaacgcattgttgagggaattcttaagagggccccagaa gaacaaaggctctttaaggatgaccagttgttagaagactgcaaaaccctaggcgattgt ggcttcaccaaccagactgcaaggccccaggctccagggactgttggactggctttccgt attggtgatgagatgtttgagcagttgcagctggaagccttctccagccccccggagctt cccgacgtcatgaagccccaggattccggcagcacggccaacgaacaggctgtgcaatga

DBGET integrated database retrieval system