Esox lucius (northern pike): 105030652 Help Entry 105030652         CDS       T04894                                  Symbol dynlt1 Name (RefSeq) dynein light chain Tctex-type 1   KO K10420   dynein light chain Tctex-type 1/3 Organism els  Esox lucius (northern pike) Pathway els04814   Motor proteins els05132   Salmonella infection Brite KEGG Orthology (KO) [BR:els00001]  09140 Cellular Processes   09142 Cell motility    04814 Motor proteins     105030652 (dynlt1)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     105030652 (dynlt1)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:els03037]     105030652 (dynlt1)    04812 Cytoskeleton proteins [BR:els04812]     105030652 (dynlt1) Cilium and associated proteins [BR:els03037]  Motile cilia and associated proteins   Dynein arm    105030652 (dynlt1) Cytoskeleton proteins [BR:els04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulin-binding proteins     Dyneins      105030652 (dynlt1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Tctex-1 PTP2 Motif Other DBs NCBI-GeneID:  105030652 NCBI-ProteinID:  NP_001291170 UniProt:  C1BWU7 LinkDB All DBs Position LG18:complement(22460014..22463366) Genome browser AA seq 112 aa AA seqDB search MDLFQNGETAFDADDVFGIIKESVEGTMGGNIFQQNRVDQWTSNVVELCLSQLSKLGKPF KYIVTCIIMQRNGAGLQTASSCFWDDTTDGSCTFKWENESMHCIVTVFGLAI NT seq 339 nt NT seq  +upstreamnt  +downstreamnt atggatttgtttcagaatggagagactgcctttgacgctgacgatgtgttcggtatcatc aaagagtcagtggaaggaaccatgggaggaaacattttccaacagaatagagtggaccaa tggacctcgaatgtcgtggagctgtgcctgagtcaacttagcaagttgggcaagcctttc aagtacatcgtgacctgcattatcatgcagaggaacggagcaggtttacagacggccagc tcatgtttctgggatgataccactgatggaagctgtacatttaagtgggagaatgagtcc atgcactgcatcgtcactgtttttggtctggccatttaa

DBGET integrated database retrieval system