Esox lucius (northern pike): 806654 Help Entry 806654            CDS       T04894                                  Symbol ND3 Name (RefSeq) NADH dehydrogenase subunit 3   KO K03880   NADH-ubiquinone oxidoreductase chain 3 [EC:7.1.1.2] Organism els  Esox lucius (northern pike) Pathway els00190   Oxidative phosphorylation els01100   Metabolic pathways Module els_M00142   NADH:ubiquinone oxidoreductase, mitochondria Brite KEGG Orthology (KO) [BR:els00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     806654 (ND3)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03029 Mitochondrial biogenesis [BR:els03029]     806654 (ND3) Enzymes [BR:els01000]  7. Translocases   7.1  Catalysing the translocation of protons    7.1.1  Linked to oxidoreductase reactions     7.1.1.2  NADH:ubiquinone reductase (H+-translocating)      806654 (ND3) Mitochondrial biogenesis [BR:els03029]  Mitochondrial DNA transcription, translation, and replication factors   Mitochondrial DNA-encoded proteins    Mitochondrial respiratory chain complex I     806654 (ND3) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Oxidored_q4 Motif Other DBs NCBI-GeneID:  806654 NCBI-ProteinID:  NP_795762 UniProt:  Q85D52 LinkDB All DBs Position MT:9608..9958 Genome browser AA seq 116 aa AA seqDB search MNLISTIFVITITLSAILATLSFWLPQMSPDTEKLSPYECGFDPLGTARLPFSLRFFLVA ILFLLFDLEIALLLPLPWADQLSSPTLTFLWATTILTLLTLGLIYEWIQGGLEWAE NT seq 349 nt NT seq  +upstreamnt  +downstreamnt atgaacctgatctcaacaatttttgttattaccattaccctctctgcaattctagccacc ctttctttctgattacctcaaataagccctgacacagaaaaattatccccatacgaatgc gggttcgaccccttaggaaccgcccgcctccccttctcactacgcttctttctagtggcc attctattccttttatttgatttagaaattgccctcctcctccccctaccttgggcagac cagctctcttcccccaccctaacatttctttgagccaccactatcttaaccctactcacc cttggcttaatttatgaatgaattcaagggggtctagagtgggctgaat

DBGET integrated database retrieval system