Elizabethkingia sp. JS20170427COW: FGE20_07450 Help Entry FGE20_07450       CDS       T06442                                  Name (GenBank) HU family DNA-binding protein   KO K03530   DNA-binding protein HU-beta Organism elt  Elizabethkingia sp. JS20170427COW Brite KEGG Orthology (KO) [BR:elt00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:elt03032]     FGE20_07450    03036 Chromosome and associated proteins [BR:elt03036]     FGE20_07450    03400 DNA repair and recombination proteins [BR:elt03400]     FGE20_07450 DNA replication proteins [BR:elt03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     FGE20_07450 Chromosome and associated proteins [BR:elt03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     FGE20_07450 DNA repair and recombination proteins [BR:elt03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       FGE20_07450 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding HU-HIG HU-CCDC81_bac_2 FtsL_2 Motif Other DBs NCBI-ProteinID:  QCX53577 UniProt:  A0A5B7UGF7 LinkDB All DBs Position complement(1647628..1647918) Genome browser AA seq 96 aa AA seqDB search MNKSELIDAIAKDAEITKVAAKKALESFISNVTETLKKKDGKISLVGFGTFSVAERAERQ GINPSTKKPIKIAAKKVAKFKAGSELSDAVNGAKKK NT seq 291 nt NT seq  +upstreamnt  +downstreamnt atgaacaaatctgaattaatcgacgctattgcaaaggatgctgaaatcacaaaagtagct gctaaaaaagcattagaatctttcatctctaatgtaactgaaactttaaaaaagaaagat ggtaaaatttctctagtaggttttggtactttctctgttgctgaaagagctgagagacaa ggtatcaacccttctactaaaaaacctatcaaaattgctgctaaaaaagttgctaaattt aaagctggatctgagctttctgacgcagttaacggtgctaaaaagaaataa

DBGET integrated database retrieval system